254781028

254781028

putative Mg2+ chelatase family protein

GeneID in NCBI database:8210051Locus tag:CLIBASIA_04650
Protein GI in NCBI database:254781028Protein Accession:YP_003065441.1
Gene range:-(1028024, 1028287)Protein Length:87aa
Gene description:putative Mg2+ chelatase family protein
COG prediction:[O] Predicted ATPase with chaperone activity
KEGG prediction:putative Mg2+ chelatase family protein
SEED prediction:putative Mg2+ chelatase family protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80-------
MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFLH
ccEEEEEEEEEEEccEEEEEEEEEcccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcHHHHHHHHHHHcc
ccHHHHHHHHccccccEEEEEEEEccccccEEEEcccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccHHHHHHHHHHHcc
MISRISTIAfqgikgipvEVQVMVspgrvgvqivglpdkavIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFLH
misristiafqgikgipvEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFLH
MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFLH
MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFL*
MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFLH
MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFLH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooo
ooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFLH
MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFLH
MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIMIYLSFLH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target87 putative Mg2+ chelatase family protein [Candidatus Libe
315122602 422 hypothetical protein CKC_04270 [Candidatus Liberibacter 1 1e-20
241207282 510 Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. 1 2e-17
116250107 510 Mg2+ chelatase family protein [Rhizobium leguminosarum 1 3e-17
327192037 540 putative Mg-chelatase protein [Rhizobium etli CNPAF512] 1 3e-17
150398731 532 Mg chelatase subunit ChlI [Sinorhizobium medicae WSM419 1 5e-17
209551905 510 Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. 1 6e-17
15964092 510 hypothetical protein SMc00420 [Sinorhizobium meliloti 1 1 8e-17
227824185 510 Mg chelatase-related protein [Sinorhizobium fredii NGR2 1 8e-17
218680983134 putative Mg2+ chelatase family protein [Rhizobium etli 1 8e-17
307317907 510 Mg chelatase, subunit ChlI [Sinorhizobium meliloti AK83 1 9e-17
>gi|315122602|ref|YP_004063091.1| hypothetical protein CKC_04270 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 422 Back     alignment and organism information
 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/57 (89%), Positives = 52/57 (91%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGL 57
          MISRISTIAFQGIKGIPVEVQVMVSPGRVG+QIVGLPDKAVIESRERIQS     GL
Sbjct: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGIQIVGLPDKAVIESRERIQSALYSCGL 57


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241207282|ref|YP_002978378.1| Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 510 Back     alignment and organism information
>gi|116250107|ref|YP_765945.1| Mg2+ chelatase family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 510 Back     alignment and organism information
>gi|327192037|gb|EGE59018.1| putative Mg-chelatase protein [Rhizobium etli CNPAF512] Length = 540 Back     alignment and organism information
>gi|150398731|ref|YP_001329198.1| Mg chelatase subunit ChlI [Sinorhizobium medicae WSM419] Length = 532 Back     alignment and organism information
>gi|209551905|ref|YP_002283822.1| Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 510 Back     alignment and organism information
>gi|15964092|ref|NP_384445.1| hypothetical protein SMc00420 [Sinorhizobium meliloti 1021] Length = 510 Back     alignment and organism information
>gi|227824185|ref|YP_002828158.1| Mg chelatase-related protein [Sinorhizobium fredii NGR234] Length = 510 Back     alignment and organism information
>gi|218680983|ref|ZP_03528880.1| putative Mg2+ chelatase family protein [Rhizobium etli CIAT 894] Length = 134 Back     alignment and organism information
>gi|307317907|ref|ZP_07597344.1| Mg chelatase, subunit ChlI [Sinorhizobium meliloti AK83] Length = 510 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target87 putative Mg2+ chelatase family protein [Candidatus Libe
TIGR00368 499 TIGR00368, TIGR00368, Mg chelatase-related protein 2e-08
PRK09862 506 PRK09862, PRK09862, putative ATP-dependent protease; Pr 4e-06
COG0606 490 COG0606, COG0606, Predicted ATPase with chaperone activ 8e-09
>gnl|CDD|129465 TIGR00368, TIGR00368, Mg chelatase-related protein Back     alignment and domain information
>gnl|CDD|182120 PRK09862, PRK09862, putative ATP-dependent protease; Provisional Back     alignment and domain information
>gnl|CDD|30951 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 87 putative Mg2+ chelatase family protein [Candidatus Libe
TIGR00368 505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 99.96
PRK09862 506 putative ATP-dependent protease; Provisional 99.96
COG0606 490 Predicted ATPase with chaperone activity [Posttranslati 99.87
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein' Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target87 putative Mg2+ chelatase family protein [Candidatus Libe
1xhk_A187 Putative protease LA homolog; LON protease, ATP depende 97.79
1rre_A 200 ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydr 96.78
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-binding, 96.7
2x36_A 207 LON protease homolog, mitochondrial; hydrolase, catalyt 96.28
1z0w_A 207 Putative protease LA homolog type; ATP-dependent protea 95.95
>1xhk_A Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} SCOP: d.14.1.10 Back     alignment and structure
Probab=97.79  E-value=6.3e-05  Score=49.28  Aligned_cols=76  Identities=11%  Similarity=0.171  Sum_probs=53.8

Q ss_pred             EEEEEEEEEEEE--EEEEEEEEEECCCCC-CEEEEEEC----CHHHHHHHHHHHHHHHHHCCCCCCCC--CCCCEEEEEE
Q ss_conf             369999999733--017899999846897-43799616----25888999899999999779844211--2894047996
Q gi|254781028|r    2 ISRISTIAFQGI--KGIPVEVQVMVSPGR-VGVQIVGL----PDKAVIESRERIQSHFIHAGLLFLVN--ELPSIYLQLI   72 (87)
Q Consensus         2 lski~S~al~Gi--~a~~V~VEv~is~Gl-P~f~iVGL----pD~aVkESreRVrsAl~nsGl~F~~~--~~p~~~~tin   72 (87)
                      +++++..+..+.  .+.++.+|+++..|. |+...+|+    ++.+++++++|+++++.+.++.+...  .++...+++|
T Consensus         6 vG~vnGLav~~~G~~G~~~~ie~~v~~~~~~g~~~~~~~G~v~keSv~~A~~~v~~~~~~~~~~~~~~~~~~~~~di~i~   85 (187)
T 1xhk_A            6 VGVIYGLAVLGAGGIGDVTKIIVQILESKNPGTHLLNISGDIAKHSITLASALSKKLVAEKKLPLPKKDIDLNNKEIYIQ   85 (187)
T ss_dssp             TTEEEEEECCSSSSCCEEEEEEEEEEECSSCEEEEESSCHHHHHHHHHHHHHHHHHHHHTTSSCCCSSCCCSTTEEEEEE
T ss_pred             EEEEEEEEEECCCCCCCEEEEEEEEEECCCCCCCEEEEECHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEE
T ss_conf             18998999978998775599999999767897036863057889999999999999998629987844466656328999


Q ss_pred             ECHHH
Q ss_conf             37588
Q gi|254781028|r   73 YQKKD   77 (87)
Q Consensus        73 l~p~d   77 (87)
                      +.|++
T Consensus        86 ~~~~~   90 (187)
T 1xhk_A           86 FSQSY   90 (187)
T ss_dssp             ESSCC
T ss_pred             ECCCC
T ss_conf             37987



>1rre_A ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli} SCOP: d.14.1.10 PDB: 1rr9_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, cytoplasm, hydrolase, nucleotide-B protease, serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2x36_A LON protease homolog, mitochondrial; hydrolase, catalytic DYAD, transit peptide; 2.00A {Homo sapiens} PDB: 2x36_C Back     alignment and structure
>1z0w_A Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target87 putative Mg2+ chelatase family protein [Candidatus Libe
d1rrea_182 ATP-dependent protease Lon (La), catalytic domain {Esch 98.43
d1xhka_185 ATP-dependent protease Lon (La), catalytic domain {Meth 97.64
>d1rrea_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: ATP-dependent protease Lon (La), catalytic domain
domain: ATP-dependent protease Lon (La), catalytic domain
species: Escherichia coli [TaxId: 562]
Probab=98.43  E-value=3.5e-07  Score=61.11  Aligned_cols=75  Identities=11%  Similarity=0.140  Sum_probs=64.0

Q ss_pred             EEEEEEEEEEEEEEEEEEEEEECCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCC--CCEEEEEEECHH
Q ss_conf             369999999733017899999846897437996162588899989999999977984421128--940479963758
Q gi|254781028|r    2 ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL--PSIYLQLIYQKK   76 (87)
Q Consensus         2 lski~S~al~Gi~a~~V~VEv~is~GlP~f~iVGLpD~aVkESreRVrsAl~nsGl~F~~~~~--p~~~~tinl~p~   76 (87)
                      +++++..++.+..+.+++||++..+|.+.+.++|+++...+|+.+|.++++++++..+.....  ....+.+++.+.
T Consensus         2 iG~v~GL~v~~~gG~ll~IEv~~~~G~g~~~~tG~~~~~~~es~~~a~~~~~~~~~~~~~~~~~~~~~di~i~~~~~   78 (182)
T d1rrea_           2 VGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEG   78 (182)
T ss_dssp             CEEEEEEEEETTEEEEEEEEEEEEECSSCEEEESSBCHHHHHHHHHHHHHHHHTHHHHTCCTTTTTSEEEEEECSST
T ss_pred             EEEEEEEEEECCCCEEEEEEEEEECCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECC
T ss_conf             69999879977898899999999858886797157402346788889999999998808982000031067874036



>d1xhka_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 87 putative Mg2+ chelatase family protein [Candidatus
1rre_A_ 200 (A:) ATP-dependent protease LA; catalytic Ser-Lys 2e-05
>1rre_A (A:) ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli}Length = 200 Back     alignment and structure
 Score = 42.8 bits (100), Expect = 2e-05
 Identities = 7/56 (12%), Positives = 22/56 (39%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAG 56
           + +++ +A+  + G  + ++    PG+  +   G   +   ES +   +      
Sbjct: 10 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVXQESIQAALTVVRARA 65


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target87 putative Mg2+ chelatase family protein [Candidatus Libe
1rre_A_ 200 ATP-dependent protease LA; catalytic Ser-Lys DYAD, 98.79
1z0w_A_ 207 Putative protease LA homolog type; ATP-dependent p 98.54
1xhk_A_187 Putative protease LA homolog; LON protease, ATP de 96.95
>1rre_A (A:) ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli} Back     alignment and structure
Probab=98.79  E-value=2e-08  Score=70.73  Aligned_cols=78  Identities=9%  Similarity=0.109  Sum_probs=70.6

Q ss_pred             CEEEEEEEEEEEEEEEEEEEEEECCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCEEEEEEECHHHH
Q ss_conf             9369999999733017899999846897437996162588899989999999977984421--12894047996375889
Q gi|254781028|r    1 MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV--NELPSIYLQLIYQKKDL   78 (87)
Q Consensus         1 Mlski~S~al~Gi~a~~V~VEv~is~GlP~f~iVGLpD~aVkESreRVrsAl~nsGl~F~~--~~~p~~~~tinl~p~dl   78 (87)
                      |+.++++.++.|.+++++.||+...+|.|.+.++|+++...+|+++|+++|+.+.+..+..  ..+|..++++|+++.|.
T Consensus        10 ~~g~v~~~~v~~~~~~~~~iE~~~~~g~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~i~i~~~~~~~   89 (200)
T 1rre_A           10 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVXQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGAT   89 (200)
T ss_dssp             CCEEEEEEEEETTEEEEEEEEEEEEECSSCEEEESSBCHHHHHHHHHHHHHHHHTHHHHTCCTTTTTSEEEEEECSSTTS
T ss_pred             CCEEEEEEEEECCCCEEEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCEEEEECCCCC
T ss_conf             62799877995799877999999982688632234554012578999999999986650677013322303454214654



>1z0w_A (A:) Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A Back     alignment and structure
>1xhk_A (A:) Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure