254781031

254781031

exsB protein

GeneID in NCBI database:8210054Locus tag:CLIBASIA_04665
Protein GI in NCBI database:254781031Protein Accession:YP_003065444.1
Gene range:-(1034843, 1035565)Protein Length:240aa
Gene description:exsB protein
COG prediction:[R] Predicted PP-loop superfamily ATPase
KEGG prediction:ExsB protein; K06920 queuosine biosynthesis protein QueC
SEED prediction:Queuosine Biosynthesis QueC ATPase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Queuosine-Archaeosine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD
ccccccccccEEEEEEccccHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHccccccccccccccccccccccEEccHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccccHHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHccccHHcccHHHcEEccccccccccHHHccccccHHHHHHHHHHHHHHHHHcc
cccccccccEEEEEEcccccHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHcHccHHHHHHccccEEcHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHHHHHHHcccccEEEccHHHHcHHHHHHHHHHHccHHHHHHHHHccccHHcccccccccccccccccHHHHHHHHHHHHHHHHHcc
mndiikkapsalllfsggqdsstCLSWALDRFdrvetlsfdygqrnkVELECRLCVRKKIVELMPKwkdslgedhilplailgdishsslTKNVAMKiqdnnlpntfvpgrNIIFLVFAATLAYRLGITNIVIGVcetdysgypdcrhDTIRAIETAINLGmeshvtvhtplmwlKKYETWKLAQDIGGQDLVNLILEEshtcylgkrdkryewgygcnscpacylrqkGWMEFKEKYQD
MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLsfdygqrnkvelecRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD
MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD
*************LFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHSSL***********NLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFK*****
MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD
*****KKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQ*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD
MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD
MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target240 exsB protein [Candidatus Liberibacter asiaticus str. ps
315122371243 exsB protein [Candidatus Liberibacter solanacearum CLso 1 1e-116
170744632233 exsB protein [Methylobacterium sp. 4-46] Length = 233 1 2e-86
220926504233 exsB protein [Methylobacterium nodulans ORS 2060] Lengt 1 5e-84
258542251246 queuosine biosynthesis protein QueC/ExsB [Acetobacter p 1 7e-84
92117391238 ExsB [Nitrobacter hamburgensis X14] Length = 238 1 7e-83
296447515238 exsB protein [Methylosinus trichosporium OB3b] Length = 1 8e-83
170748385239 exsB protein [Methylobacterium radiotolerans JCM 2831] 1 1e-82
329113418262 7-cyano-7-deazaguanine synthase [Acetobacter pomorum DM 1 2e-82
158425299241 ExsB protein [Azorhizobium caulinodans ORS 571] Length 1 6e-82
192291524237 exsB protein [Rhodopseudomonas palustris TIE-1] Length 1 3e-81
>gi|315122371|ref|YP_004062860.1| exsB protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 243 Back     alignment and organism information
 Score =  420 bits (1080), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 195/239 (81%), Positives = 219/239 (91%)

Query: 1   MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKI 60
           MN+  +K  SALLLFSGGQDSSTCLSWALD+FD+VETLSFDYGQRNKVELECRL +R+KI
Sbjct: 1   MNNNREKTSSALLLFSGGQDSSTCLSWALDKFDKVETLSFDYGQRNKVELECRLRLREKI 60

Query: 61  VELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAA 120
           V+L PKWKDSLG DHILPLA LGDISHSSLTKN+ +KIQ+NNLPNTFVPGRNIIFLVFAA
Sbjct: 61  VQLTPKWKDSLGADHILPLATLGDISHSSLTKNIEIKIQENNLPNTFVPGRNIIFLVFAA 120

Query: 121 TLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYET 180
            LAYR GITNI+ G+CE DYSGYPDCR++TI+A+E  +NLGMES+ T+HTPLM LKK+ET
Sbjct: 121 ALAYRRGITNIIAGMCEMDYSGYPDCRNETIKALEMTLNLGMESNFTIHTPLMHLKKHET 180

Query: 181 WKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQ 239
           WKL QDIGGQ+LV+LILEESHTCYLG RDKRYEWGYGCNSCP+C LRQKGW+EFKEKYQ
Sbjct: 181 WKLVQDIGGQNLVDLILEESHTCYLGTRDKRYEWGYGCNSCPSCNLRQKGWVEFKEKYQ 239


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|170744632|ref|YP_001773287.1| exsB protein [Methylobacterium sp. 4-46] Length = 233 Back     alignment and organism information
>gi|220926504|ref|YP_002501806.1| exsB protein [Methylobacterium nodulans ORS 2060] Length = 233 Back     alignment and organism information
>gi|258542251|ref|YP_003187684.1| queuosine biosynthesis protein QueC/ExsB [Acetobacter pasteurianus IFO 3283-01] Length = 246 Back     alignment and organism information
>gi|92117391|ref|YP_577120.1| ExsB [Nitrobacter hamburgensis X14] Length = 238 Back     alignment and organism information
>gi|296447515|ref|ZP_06889438.1| exsB protein [Methylosinus trichosporium OB3b] Length = 238 Back     alignment and organism information
>gi|170748385|ref|YP_001754645.1| exsB protein [Methylobacterium radiotolerans JCM 2831] Length = 239 Back     alignment and organism information
>gi|329113418|ref|ZP_08242199.1| 7-cyano-7-deazaguanine synthase [Acetobacter pomorum DM001] Length = 262 Back     alignment and organism information
>gi|158425299|ref|YP_001526591.1| ExsB protein [Azorhizobium caulinodans ORS 571] Length = 241 Back     alignment and organism information
>gi|192291524|ref|YP_001992129.1| exsB protein [Rhodopseudomonas palustris TIE-1] Length = 237 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target240 exsB protein [Candidatus Liberibacter asiaticus str. ps
TIGR00364201 TIGR00364, TIGR00364, exsB protein 5e-63
PRK11106231 PRK11106, PRK11106, queuosine biosynthesis protein QueC 2e-57
cd01995169 cd01995, ExsB, ExsB is a transcription regulator relate 4e-52
COG0603222 COG0603, COG0603, Predicted PP-loop superfamily ATPase 4e-59
pfam06508137 pfam06508, ExsB, ExsB 1e-47
cd01986103 cd01986, Alpha_ANH_like, Adenine nucleotide alpha hydro 0.004
>gnl|CDD|129461 TIGR00364, TIGR00364, exsB protein Back     alignment and domain information
>gnl|CDD|182967 PRK11106, PRK11106, queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>gnl|CDD|73293 cd01995, ExsB, ExsB is a transcription regulator related protein Back     alignment and domain information
>gnl|CDD|30948 COG0603, COG0603, Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|148238 pfam06508, ExsB, ExsB Back     alignment and domain information
>gnl|CDD|73292 cd01986, Alpha_ANH_like, Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 240 exsB protein [Candidatus Liberibacter asiaticus str. ps
PRK11106231 queuosine biosynthesis protein QueC; Provisional 100.0
COG0603222 Predicted PP-loop superfamily ATPase [General function 100.0
TIGR00364227 TIGR00364 exsB protein; InterPro: IPR004479 This protei 100.0
cd01995169 ExsB ExsB is a transcription regulator related protein. 100.0
PRK06850 488 hypothetical protein; Provisional 98.12
pfam06508137 ExsB ExsB. This family includes putative transcriptiona 99.91
TIGR03573343 WbuX N-acetyl sugar amidotransferase. This enzyme has b 97.92
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine nucle 97.68
TIGR01536646 asn_synth_AEB asparagine synthase (glutamine-hydrolyzin 97.55
pfam02568197 ThiI Thiamine biosynthesis protein (ThiI). ThiI is requ 99.72
PRK08349198 hypothetical protein; Validated 99.71
cd01712177 ThiI ThiI is required for thiazole synthesis in the thi 99.71
PRK01565399 thiamine biosynthesis protein ThiI; Provisional 99.71
PRK01269483 thiamine biosynthesis protein ThiI; Provisional 99.67
COG0301383 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzym 99.67
TIGR00342391 TIGR00342 thiamine biosynthesis/tRNA modification prote 99.66
PRK08384310 thiamine biosynthesis protein ThiI; Provisional 99.45
PRK00143 355 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 99.37
COG0482 356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate 99.34
PRK05370 447 argininosuccinate synthase; Validated 99.27
cd01998 349 tRNA_Me_trans tRNA methyl transferase. This family repr 99.26
pfam03054 354 tRNA_Me_trans tRNA methyl transferase. This family repr 99.25
PRK00509 398 argininosuccinate synthase; Provisional 99.24
TIGR02432204 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro 99.23
PRK13820 395 argininosuccinate synthase; Provisional 99.22
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle contr 99.21
pfam01171182 ATP_bind_3 PP-loop family. This family of proteins belo 99.2
COG1606269 ATP-utilizing enzymes of the PP-loop superfamily [Gener 99.18
TIGR00032 420 argG argininosuccinate synthase; InterPro: IPR001518 Ar 99.16
PRK04527 397 argininosuccinate synthase; Provisional 99.14
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of the 99.14
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine nucleo 99.14
TIGR00268263 TIGR00268 conserved hypothetical protein TIGR00268; Int 99.12
pfam00764 389 Arginosuc_synth Arginosuccinate synthase. This family c 99.11
COG0137 403 ArgG Argininosuccinate synthase [Amino acid transport a 99.1
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nucleot 99.1
TIGR00884319 guaA_Cterm GMP synthase, C-terminal domain; InterPro: I 99.09
cd01999 385 Argininosuccinate_Synthase Argininosuccinate synthase. 99.07
TIGR00420 394 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 99.05
PRK10660 433 tilS tRNA(Ile)-lysidine synthetase; Provisional 99.05
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthetase. 98.89
PRK00919306 GMP synthase subunit B; Validated 98.88
PRK00074513 guaA GMP synthase; Reviewed 98.86
KOG2805 377 consensus 98.85
PRK10696311 C32 tRNA thiolase; Provisional 98.73
COG0519315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide 98.69
pfam01507174 PAPS_reduct Phosphoadenosine phosphosulfate reductase f 98.57
PRK05253300 sulfate adenylyltransferase subunit 2; Provisional 98.56
PRK12563312 sulfate adenylyltransferase subunit 2; Provisional 98.48
cd01713173 PAPS_reductase This domain is found in phosphoadenosine 98.45
pfam02540243 NAD_synthase NAD synthase. NAD synthase (EC:6.3.5.1) is 98.28
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which cataly 98.27
COG2117198 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouri 98.18
PRK13980264 NAD synthetase; Provisional 98.1
TIGR02039295 CysD sulfate adenylyltransferase, small subunit; InterP 98.09
TIGR03183 447 DNA_S_dndC putative sulfurtransferase DndC. Members of 98.04
COG0175261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransfe 98.02
PRK13981543 NAD synthetase; Provisional 98.01
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine nucleo 97.91
pfam01902219 ATP_bind_4 ATP-binding region. This family of proteins 97.59
COG1365255 Predicted ATPase (PP-loop superfamily) [General functio 97.19
COG2102223 Predicted ATPases of PP-loop superfamily [General funct 97.09
PRK02090243 phosphoadenosine phosphosulfate reductase; Provisional 96.47
KOG2594396 consensus 95.12
TIGR00552286 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase 95.02
KOG1706 412 consensus 98.67
KOG1622552 consensus 98.16
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases supe 98.1
PRK00876325 nadE NAD synthetase; Reviewed 98.03
PRK08576439 hypothetical protein; Provisional 98.0
PRK08557420 hypothetical protein; Provisional 97.96
PRK13794473 hypothetical protein; Provisional 97.94
cd01991269 Asn_Synthase_B_C The C-terminal domain of Asparagine Sy 97.85
pfam00733195 Asn_synthase Asparagine synthase. This family is always 97.83
COG0171268 NadE NAD synthase [Coenzyme metabolism] 97.71
PRK13795 630 hypothetical protein; Provisional 97.68
PTZ00077 610 asparagine synthetase; Provisional 97.33
TIGR03108 628 eps_aminotran_1 exosortase 1 system-associated amidotra 97.28
TIGR00289227 TIGR00289 conserved hypothetical protein TIGR00289; Int 97.16
PRK02628678 nadE NAD synthetase; Reviewed 97.12
COG0367542 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino 97.03
TIGR03104589 trio_amidotrans asparagine synthase family amidotransfe 97.02
PRK09431555 asnB asparagine synthetase B; Provisional 96.71
cd0198486 AANH_like Adenine nucleotide alpha hydrolases superfami 96.65
COG3969 407 Predicted phosphoadenosine phosphosulfate sulfotransfer 96.52
KOG0571543 consensus 95.95
KOG2316277 consensus 90.61
PRK00768274 nadE NAD synthetase; Reviewed 97.66
PTZ00323294 NAD+ synthase; Provisional 97.38
KOG0573520 consensus 96.2
>PRK11106 queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>TIGR00364 TIGR00364 exsB protein; InterPro: IPR004479 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>PRK06850 hypothetical protein; Provisional Back     alignment and domain information
>pfam06508 ExsB ExsB Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing); InterPro: IPR006426 These sequences represent glutamine-hydrolysing asparagine synthase Back     alignment and domain information
>pfam02568 ThiI Thiamine biosynthesis protein (ThiI) Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK01269 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00342 TIGR00342 thiamine biosynthesis/tRNA modification protein ThiI; InterPro: IPR003720 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05370 argininosuccinate synthase; Validated Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>pfam03054 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro: IPR012795 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>pfam01171 ATP_bind_3 PP-loop family Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>PRK04527 argininosuccinate synthase; Provisional Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR00268 TIGR00268 conserved hypothetical protein TIGR00268; InterPro: IPR005232 This family of conserved hypothetical proteins has no known function but is predicted to be part of the wider PP-loop superfamily Back     alignment and domain information
>pfam00764 Arginosuc_synth Arginosuccinate synthase Back     alignment and domain information
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase, C-terminal domain; InterPro: IPR001674 The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme Back     alignment and domain information
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; InterPro: IPR004506 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (2 Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>KOG2805 consensus Back     alignment and domain information
>PRK10696 C32 tRNA thiolase; Provisional Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>pfam02540 NAD_synthase NAD synthase Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit; InterPro: IPR011784 Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates Back     alignment and domain information
>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC Back     alignment and domain information
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>pfam01902 ATP_bind_4 ATP-binding region Back     alignment and domain information
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>KOG2594 consensus Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase (6 Back     alignment and domain information
>KOG1706 consensus Back     alignment and domain information
>KOG1622 consensus Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>PRK08557 hypothetical protein; Provisional Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>pfam00733 Asn_synthase Asparagine synthase Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00077 asparagine synthetase; Provisional Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>TIGR00289 TIGR00289 conserved hypothetical protein TIGR00289; InterPro: IPR005237 This family of conserved hypothetical proteins has no known function Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only] Back     alignment and domain information
>KOG0571 consensus Back     alignment and domain information
>KOG2316 consensus Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>KOG0573 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target240 exsB protein [Candidatus Liberibacter asiaticus str. ps
3bl5_A219 Crystal Structure Of Quec From Bacillus Subtilis: A 2e-42
2pg3_A232 Crystal Structure Of Hypothetical Protein (Yp_04926 2e-38
2c5s_A413 Crystal Structure Of Bacillus Anthracis Thii, A Trn 2e-18
2dpl_A308 Crystal Structure Of The Gmp Synthase From Pyrococc 2e-06
2vxo_A 697 Human Gmp Synthetase In Complex With Xmp Length = 6 2e-06
2der_A 380 Cocrystal Structure Of An Rna Sulfuration Enzyme Mn 7e-06
2ywc_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 4e-04
2ywb_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 4e-04
1vl2_A 421 Crystal Structure Of Argininosuccinate Synthase (Tm 0.002
gi|189339604|pdb|3BL5|A Chain A, Crystal Structure Of Quec From Bacillus Subtilis: An Enzyme Involved In Preq1 Biosynthesis Length = 219 Back     alignment and structure
 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 99/229 (43%), Positives = 149/229 (65%), Gaps = 20/229 (8%)

Query: 7   KAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPK 66
           K   A+++FSGGQDS+TCL WAL  F+ VET++F Y QR+  E+E    + +K+      
Sbjct: 2   KKEKAIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQRHSQEVEVAKSIAEKLG----- 56

Query: 67  WKDSLGEDHILPLAILGDISHSSLTK-NVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYR 125
                 ++H+L +++L  ++ ++LT+ ++ ++++D  LP+TFVPGRN++FL FA+ LAY+
Sbjct: 57  -----VKNHLLDMSLLNQLAPNALTRNDIEIEVKDGELPSTFVPGRNLVFLSFASILAYQ 111

Query: 126 LGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQ 185
           +G  +I+ GVCETD+SGYPDCR + +++    +NL ME    +HTPLMWL K ETWKLA 
Sbjct: 112 IGARHIITGVCETDFSGYPDCRDEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLAD 171

Query: 186 DIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEF 234
           ++G  D V      + TCY G          GC  CPAC+LR KG+ E+
Sbjct: 172 ELGALDFVK---NNTLTCYNGI------IADGCGECPACHLRSKGYEEY 211


>gi|146387132|pdb|2PG3|A Chain A, Crystal Structure Of Hypothetical Protein (Yp_049261.1) From Erwinia Carotovora Subsp. Atroseptica Scri1043 At 2.40 A Resolution Length = 232 Back     alignment and structure
>gi|83754678|pdb|2C5S|A Chain A, Crystal Structure Of Bacillus Anthracis Thii, A Trna- Modifying Enzyme Containing The Predicted Rna-Binding Thump Domain Length = 413 Back     alignment and structure
gi|119389212|pdb|2DPL|A Chain A, Crystal Structure Of The Gmp Synthase From Pyrococcus Horikoshii Ot3 Length = 308 Back     alignment and structure
>gi|196049679|pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 Back     alignment and structure
>gi|114793688|pdb|2DER|A Chain A, Cocrystal Structure Of An Rna Sulfuration Enzyme Mnma And Trna-Glu In The Initial Trna Binding State Length = 380 Back     alignment and structure
>gi|159795613|pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
gi|159795609|pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure
>gi|52696139|pdb|1VL2|A Chain A, Crystal Structure Of Argininosuccinate Synthase (Tm1780) From Thermotoga Maritima At 1.65 A Resolution Length = 421 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target240 exsB protein [Candidatus Liberibacter asiaticus str. ps
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis 2e-54
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, hypot 3e-37
2c5s_A413 THII, probable thiamine biosynthesis protein THII; RNA- 1e-07
3k32_A203 Uncharacterized protein MJ0690; predicted subunit of tR 1e-06
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Length = 219 Back     alignment and structure
 Score =  207 bits (527), Expect = 2e-54
 Identities = 98/226 (43%), Positives = 150/226 (66%), Gaps = 22/226 (9%)

Query: 11  ALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDS 70
           A+++FSGGQDS+TCL WAL  F+ VET++F Y QR+  E+E    + +K           
Sbjct: 6   AIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQRHSQEVEVAKSIAEK----------- 54

Query: 71  LG-EDHILPLAILGDISHSSLTK-NVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGI 128
           LG ++H+L +++L  ++ ++LT+ ++ ++++D  LP+TFVPGRN++FL FA+ LAY++G 
Sbjct: 55  LGVKNHLLDMSLLNQLAPNALTRNDIEIEVKDGELPSTFVPGRNLVFLSFASILAYQIGA 114

Query: 129 TNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIG 188
            +I+ GVCETD+SGYPDCR + +++    +NL ME    +HTPLMWL K ETWKLA ++G
Sbjct: 115 RHIITGVCETDFSGYPDCRDEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELG 174

Query: 189 GQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEF 234
               ++ +   + TCY G          GC  CPAC+LR KG+ E+
Sbjct: 175 ---ALDFVKNNTLTCYNG------IIADGCGECPACHLRSKGYEEY 211


>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Length = 232 Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Length = 413 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Length = 203 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target240 exsB protein [Candidatus Liberibacter asiaticus str. ps
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, hypot 100.0
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis 100.0
2c5s_A413 THII, probable thiamine biosynthesis protein THII; RNA- 99.7
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA complex 99.52
2hma_A 376 Probable tRNA (5-methylaminomethyl-2- thiouridylate)-me 99.46
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesis, as 99.33
1vl2_A 421 Argininosuccinate synthase; TM1780, structural genomics 99.31
3k32_A203 Uncharacterized protein MJ0690; predicted subunit of tR 99.3
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzing] su 99.28
1vbk_A307 Hypothetical protein PH1313; structural genomics, riken 99.26
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligas 99.24
1k92_A 455 Argininosuccinate synthase, argininosuccinate; N-type A 99.22
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP- 99.21
1ni5_A 433 Putative cell cycle protein MESJ; structural genomics, 99.18
1kor_A 400 Argininosuccinate synthetase; ligase, riken structural 99.12
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncogene, p 98.96
1xng_A268 NH(3)-dependent NAD(+) synthetase; amidotransferase, li 98.92
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine amidotra 98.87
3p52_A249 NH(3)-dependent NAD(+) synthetase; structural genomics, 98.85
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP synthetase, X 98.83
2e18_A257 NH(3)-dependent NAD(+) synthetase; ligase, structural g 98.7
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfide cr 98.51
1kqp_A271 NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; liga 98.27
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3-phosp 98.19
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate redu 97.85
2d13_A227 Hypothetical protein PH1257; structural genomics, NPPSF 97.31
3fiu_A249 NH(3)-dependent NAD(+) synthetase; rossman fold, adenin 98.91
3dpi_A285 NAD+ synthetase; ssgcid, decode, structural genomics, P 98.53
1wxi_A275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase 98.31
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel, swi 98.3
1jgt_A513 Beta-lactam synthetase; asparagine synthetase, clavulan 97.56
1q15_A503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lac 97.56
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cluster 97.5
3n05_A590 NH(3)-dependent NAD(+) synthetase; ligase, structural g 97.39
1ct9_A553 Asparagine synthetase B; amidotransferase, substrate ch 96.95
3dla_A680 Glutamine-dependent NAD(+) synthetase; glutaminase, amm 96.95
3ilv_A634 Glutamine-dependent NAD(+) synthetase; protein structur 95.12
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/beta p 97.63
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferase, nu 97.53
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
Probab=100.00  E-value=4.7e-43  Score=284.67  Aligned_cols=211  Identities=42%  Similarity=0.830  Sum_probs=161.0

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHCCCCCC
Q ss_conf             94899980965699999999974983999997677887772799999999999998887520356158750110322444
Q gi|254781031|r    9 PSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHS   88 (240)
Q Consensus         9 ~~av~l~SGGlDS~~~l~~l~~~~~~v~~i~~~ygq~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (240)
                      ||||+||||||||+++|++++++|++|++|||||||+|..+.+.+....++..         ...........+......
T Consensus         3 kk~VvL~SGGlDS~v~a~~l~~~g~~v~~l~~~yGq~~~~e~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~   73 (232)
T 2pg3_A            3 KRAVVVFSGGQDSTTCLIQALQDYDDVHCITFDYGQRHRAEIEVAQELSQKLG---------AAAHKVLDVGLLNELATS   73 (232)
T ss_dssp             CEEEEECCSSHHHHHHHHHHHHHCSEEEEEEEESSSSCHHHHHHHHHHHHHHT---------CSEEEEEECTHHHHTSHH
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEECCCCHHHHHHHHHHHHHHHH---------CCCCCCCCHHHHHHCCCC
T ss_conf             86999836808999999999976996999999799832999999998665431---------012101204555413565


Q ss_pred             CCC----CCHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             332----2201100012331011111112233377777743399365114544443455544302477777677530643
Q gi|254781031|r   89 SLT----KNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMES  164 (240)
Q Consensus        89 ~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~g~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (240)
                      ...    ...............+++.++..++..+..++...++..+..|...++...++++++.|.+.+++++....+.
T Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~l~~a~~~a~~~~~~~~~~G~~~~d~~~~~d~~~~f~~~~~~~~~~~~~~  153 (232)
T 2pg3_A           74 SLTRDSIPVPDYDANAQGIPNTFVPGRNILFLTLASIYAYQVGAEAVITGVCETDFSGYPDCRDEFVKALNQAIVLGIAR  153 (232)
T ss_dssp             HHHHTTCCCCC---------CCCCTTHHHHHHHHHHHHHHHHTCSEEECCCCSCSSSCCGGGSHHHHHHHHHHHHHHHTS
T ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             43344444432110023665235301308878999999998399753124446666677764486999999999855777


Q ss_pred             CEEEEEEECCCCHHHHHHHHHHHCCCHHCCCCHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             2167753138988999999998282000143255372162888655556688998687789999999973064
Q gi|254781031|r  165 HVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEK  237 (240)
Q Consensus       165 ~~~i~~P~~~~tK~eI~~~~~~~~~~~~~~~~~~~T~SC~~~~~~~~~~~~~hCG~C~~C~~R~~af~~~~~~  237 (240)
                      +++|++||+++||+||++++.+.+   .+++++..|||||+|..      ..|||+|.+|++||+||.++|..
T Consensus       154 ~~~i~~P~~~~tK~Ei~~~~~~~~---~l~~~~~~T~SC~~~~~------~~~CG~C~~C~~Rr~af~~~~~~  217 (232)
T 2pg3_A          154 DIRFETPLMWLNKAETWALADYYQ---QLDTVRYHTLTCYNGIK------GDGCGQCAACHLRANGLAQYQKD  217 (232)
T ss_dssp             CCEEECTTTTCCHHHHHHHHHHTT---CHHHHHHHCCCCTTSCC------TTTTSCSHHHHHHHHHHHHHHHS
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHC---CCCCCCCCCCCCCCCCC------CCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             726995022588899999854312---35854312277789799------99798897799999999985799



>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, structural genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii OT3} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATP, ATPase, PP-type, PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphatase, transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli K12} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway; 2.10A {Thermus thermophilus HB8} PDB: 2ywc_A* Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1kqp_A NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2d13_A Hypothetical protein PH1257; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Pyrococcus horikoshii} SCOP: c.26.2.1 PDB: 3h7e_A* 1ru8_A Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic acid, AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* Back     alignment and structure
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* Back     alignment and structure
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Back     alignment and structure
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 Back     alignment and structure
>3dla_A Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 240 exsB protein [Candidatus Liberibacter asiaticus str. ps
d2pg3a1230 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC 1e-41
d2c5sa1218 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI 2e-06
d1k92a1188 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-term 6e-05
>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: N-type ATP pyrophosphatases
domain: Queuosine biosynthesis protein QueC
species: Erwinia carotovora [TaxId: 554]
 Score =  163 bits (413), Expect = 1e-41
 Identities = 87/227 (38%), Positives = 123/227 (54%), Gaps = 14/227 (6%)

Query: 11  ALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDS 70
           A+++FSGGQDS+TCL  AL  +D V  ++FDYGQR++ E+E    + +K+     K    
Sbjct: 4   AVVVFSGGQDSTTCLIQALQDYDDVHCITFDYGQRHRAEIEVAQELSQKLGAAAHKVL-- 61

Query: 71  LGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITN 130
              D  L   +                     +PNTFVPGRNI+FL  A+  AY++G   
Sbjct: 62  ---DVGLLNELATSSLTRDSIPVPDYDANAQGIPNTFVPGRNILFLTLASIYAYQVGAEA 118

Query: 131 IVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQ 190
           ++ GVCETD+SGYPDCR + ++A+  AI LG+   +   TPLMWL K ETW LA      
Sbjct: 119 VITGVCETDFSGYPDCRDEFVKALNQAIVLGIARDIRFETPLMWLNKAETWALADYYQQL 178

Query: 191 DLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEK 237
           D    +   + TCY G +      G GC  C AC+LR  G  ++++ 
Sbjct: 179 D---TVRYHTLTCYNGIK------GDGCGQCAACHLRANGLAQYQKD 216


>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Length = 218 Back     information, alignment and structure
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target240 exsB protein [Candidatus Liberibacter asiaticus str. ps
d2pg3a1230 Queuosine biosynthesis protein QueC {Erwinia carotovora 100.0
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal domain { 99.72
d1k92a1188 Argininosuccinate synthetase, N-terminal domain {Escher 99.51
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Archaeo 99.34
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 633 99.31
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal domain { 99.25
d1xnga1255 NH3-dependent NAD+-synthetase {Helicobacter pylori [Tax 98.84
d1sura_215 Phosphoadenylyl sulphate (PAPS) reductase {Escherichia 98.36
d1kqpa_271 NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId 98.18
d2d13a1226 Hypothetical protein PH1257 {Archaeon Pyrococcus horiko 97.86
d1vl2a1168 Argininosuccinate synthetase, N-terminal domain {Thermo 99.2
d1gpma1197 GMP synthetase, central domain {Escherichia coli [TaxId 99.18
d1j20a1165 Argininosuccinate synthetase, N-terminal domain {Thermu 99.01
d1zuna1211 Sulfate adenylyltransferase subunit 2, CysD {Pseudomona 98.32
d1wxia1274 NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 98.29
d1q15a1296 beta-Lactam synthetase {Pectobacterium carotovorum [Tax 97.93
d1jgta1299 beta-Lactam synthetase {Streptomyces clavuligerus [TaxI 97.82
d1ct9a1324 Asparagine synthetase B, C-terminal domain {Escherichia 96.75
>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: N-type ATP pyrophosphatases
domain: Queuosine biosynthesis protein QueC
species: Erwinia carotovora [TaxId: 554]
Probab=100.00  E-value=6.5e-43  Score=282.34  Aligned_cols=211  Identities=42%  Similarity=0.842  Sum_probs=162.5

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHCCCCCC
Q ss_conf             94899980965699999999974983999997677887772799999999999998887520356158750110322444
Q gi|254781031|r    9 PSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDSLGEDHILPLAILGDISHS   88 (240)
Q Consensus         9 ~~av~l~SGGlDS~~~l~~l~~~~~~v~~i~~~ygq~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (240)
                      ||+|+|||||+||+++||+++++|++|++|||||||+|..+.+++....++..         ...........+......
T Consensus         2 kK~Vvl~SGGlDS~v~a~~l~~~g~~v~~v~~~ygqr~~~E~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~   72 (230)
T d2pg3a1           2 KRAVVVFSGGQDSTTCLIQALQDYDDVHCITFDYGQRHRAEIEVAQELSQKLG---------AAAHKVLDVGLLNELATS   72 (230)
T ss_dssp             CEEEEECCSSHHHHHHHHHHHHHCSEEEEEEEESSSSCHHHHHHHHHHHHHHT---------CSEEEEEECTHHHHTSHH
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHHHHHHC---------CCCCCCCCHHHHHHCCCC
T ss_conf             86999848868899999999986996999999889754899999987677635---------440122103344312455


Q ss_pred             CCCCC----HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             33222----01100012331011111112233377777743399365114544443455544302477777677530643
Q gi|254781031|r   89 SLTKN----VAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMES  164 (240)
Q Consensus        89 ~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~g~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (240)
                      .....    .............+.|.++..++..+..++...++..+.+|...++...++++++.|.+.+++++....+.
T Consensus        73 ~~~~~~~~~~~~~~~~~~~~~~~~p~r~~~~l~~~~~~a~~~~~~~i~~G~~~~d~~~~~d~~~~f~~~~~~~~~~~~~~  152 (230)
T d2pg3a1          73 SLTRDSIPVPDYDANAQGIPNTFVPGRNILFLTLASIYAYQVGAEAVITGVCETDFSGYPDCRDEFVKALNQAIVLGIAR  152 (230)
T ss_dssp             HHHHTTCCCCC---------CCCCTTHHHHHHHHHHHHHHHHTCSEEECCCCSCSSSCCGGGSHHHHHHHHHHHHHHHTS
T ss_pred             CCCCCCCCCCCHHHHHCCCCCEEEEECHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             43344544320234412677526650068889999999887212121454333433356654076899999887751566


Q ss_pred             CEEEEEEECCCCHHHHHHHHHHHCCCHHCCCCHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             2167753138988999999998282000143255372162888655556688998687789999999973064
Q gi|254781031|r  165 HVTVHTPLMWLKKYETWKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEK  237 (240)
Q Consensus       165 ~~~i~~P~~~~tK~eI~~~~~~~~~~~~~~~~~~~T~SC~~~~~~~~~~~~~hCG~C~~C~~R~~af~~~~~~  237 (240)
                      ++++++||+++||.||++++.+++   .+..++..|||||.|.+      ..|||+|.+|++||+||.+++..
T Consensus       153 ~~~i~~P~~~~tK~EI~~~~~~~~---~l~~~~~~T~SCy~~~~------~~~CG~C~~C~~R~~af~~~~~~  216 (230)
T d2pg3a1         153 DIRFETPLMWLNKAETWALADYYQ---QLDTVRYHTLTCYNGIK------GDGCGQCAACHLRANGLAQYQKD  216 (230)
T ss_dssp             CCEEECTTTTCCHHHHHHHHHHTT---CHHHHHHHCCCCTTSCC------TTTTSCSHHHHHHHHHHHHHHHS
T ss_pred             CCEEEEEEECCCHHHHHHHHHHCC---CCCCCHHCCCCCCCCCC------CCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             532686431588999999987605---65642302188889999------99798898699999999995799



>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1wxia1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q15a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ct9a1 c.26.2.1 (A:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 240 exsB protein [Candidatus Liberibacter asiaticus st
3bl5_A_219 (A:) Queuosine biosynthesis protein QUEC; PREQ1 bi 1e-21
2c5s_A_183-413231 (A:183-413) THII, probable thiamine biosynthesis p 8e-15
3dla_A_323-553231 (A:323-553) Glutamine-dependent NAD(+) synthetase; 3e-10
3fiu_A_249 (A:) NH(3)-dependent NAD(+) synthetase; rossman fo 2e-08
2o8v_A_252 (A:) Phosphoadenosine phosphosulfate reductase; di 4e-06
2pg3_A_1-162162 (A:1-162) Queuosine biosynthesis protein QUEC; YP_ 6e-21
1vl2_A_1-183183 (A:1-183) Argininosuccinate synthase; TM1780, stru 2e-15
2nz2_A_1-168168 (A:1-168) Argininosuccinate synthase; amino-acid b 2e-15
2hma_A_1-199199 (A:1-199) Probable tRNA (5-methylaminomethyl-2- th 2e-15
1k92_A_1-183183 (A:1-183) Argininosuccinate synthase, argininosucc 4e-14
2vxo_A_218-446229 (A:218-446) GMP synthase [glutamine-hydrolyzing]; 3e-13
2der_A_1-207207 (A:1-207) TRNA-specific 2-thiouridylase MNMA; prot 1e-12
1kor_A_1-165165 (A:1-165) Argininosuccinate synthetase; ligase, ri 4e-12
1q15_A_237-397_442-503223 (A:237-397,A:442-503) CARA; CMPR, (2S,5S)-5-carbox 2e-11
1kqp_A_15-212198 (A:15-212) NAD+ synthase;, NH(3)-dependent NAD(+) 3e-11
3k32_A_203 (A:) Uncharacterized protein MJ0690; predicted sub 1e-10
1wxi_A_16-215200 (A:16-215) NH(3)-dependent NAD(+) synthetase; NADE 1e-10
2ywb_A_189-382194 (A:189-382) GMP synthase [glutamine-hydrolyzing]; 3e-10
2dpl_A_1-189189 (A:1-189) GMP synthetase, GMP synthase [glutamine- 3e-09
1sur_A_215 (A:) PAPS reductase; assimilatory sulfate reductio 9e-09
1gpm_A_205-404200 (A:205-404) GMP synthetase, XMP aminase; class I g 1e-07
1wy5_A_1-217217 (A:1-217) TILS, hypothetical UPF0072 protein AQ_18 6e-07
3a2k_A_1-215215 (A:1-215) TRNA(Ile)-lysidine synthase; ligase, pse 2e-05
2pg3_A_163-23270 (A:163-232) Queuosine biosynthesis protein QUEC; Y 4e-12
2d13_A_1-124124 (A:1-124) Hypothetical protein PH1257; structural 5e-07
2e18_A_1-129129 (A:1-129) NH(3)-dependent NAD(+) synthetase; ligas 1e-04
1xng_A_1-132132 (A:1-132) NH(3)-dependent NAD(+) synthetase; amido 0.001
>3bl5_A (A:) Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis}Length = 219 Back     alignment and structure
 Score = 98.2 bits (243), Expect = 1e-21
 Identities = 93/224 (41%), Positives = 137/224 (61%), Gaps = 18/224 (8%)

Query: 11  ALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKIVELMPKWKDS 70
           A+++FSGGQDS+TCL WAL  F+ VET++F Y QR+  E+E    + +K+         S
Sbjct: 6   AIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQRHSQEVEVAKSIAEKLGVKNHLLDMS 65

Query: 71  LGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLGITN 130
           L               ++    ++ ++++D  LP+TFVPGRN++FL FA+ LAY++G  +
Sbjct: 66  LLNQLAP---------NALTRNDIEIEVKDGELPSTFVPGRNLVFLSFASILAYQIGARH 116

Query: 131 IVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYETWKLAQDIGGQ 190
           I+ GVCETD+SGYPDCR + +++    +NL ME    +HTPLMWL K ETWKLA ++G  
Sbjct: 117 IITGVCETDFSGYPDCRDEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELG-- 174

Query: 191 DLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEF 234
             ++ +   + TCY G          GC  CPAC+LR KG+ E+
Sbjct: 175 -ALDFVKNNTLTCYNG------IIADGCGECPACHLRSKGYEEY 211


>2c5s_A (A:183-413) THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis}Length = 231 Back     alignment and structure
>3dla_A (A:323-553) Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis}Length = 231 Back     alignment and structure
>3fiu_A (A:) NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp}Length = 249 Back     alignment and structure
>2o8v_A (A:) Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli}Length = 252 Back     alignment and structure
>2pg3_A (A:1-162) Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043}Length = 162 Back     alignment and structure
>1vl2_A (A:1-183) Argininosuccinate synthase; TM1780, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.65A {Thermotoga maritima}Length = 183 Back     alignment and structure
>2hma_A (A:1-199) Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae}Length = 199 Back     alignment and structure
>1k92_A (A:1-183) Argininosuccinate synthase, argininosuccinate; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli}Length = 183 Back     alignment and structure
>2vxo_A (A:218-446) GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens}Length = 229 Back     alignment and structure
>2der_A (A:1-207) TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A*Length = 207 Back     alignment and structure