254781032

254781032

hypothetical protein CLIBASIA_04670

GeneID in NCBI database:8210055Locus tag:CLIBASIA_04670
Protein GI in NCBI database:254781032Protein Accession:YP_003065445.1
Gene range:-(1035565, 1035921)Protein Length:118aa
Gene description:hypothetical protein
COG prediction:[H] 6-pyruvoyl-tetrahydropterin synthase
KEGG prediction:hypothetical protein; K01737 6-pyruvoyl tetrahydrobiopterin synthase [EC:4.2.3.12]
SEED prediction:Queuosine biosynthesis QueD, PTPS-I
Pathway involved in KEGG:Folate biosynthesis [PATH:las00790]
Subsystem involved in SEED:Queuosine-Archaeosine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF
cEEEEEEEEEcccccccccccccccccccccEEEEEEEEEcccccccEEEEHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEc
ccEEEEEEEcHHHcccccccccccccccccEEEEEEEEEcccccccccEEcHHHHHHHHHHHHHHccHHHHccccccccccHHHHHHHHHHHHHHHcccEEEEEEEEccccEEEEccc
MKITQAFTFeaahrlprvpkthkchrmhghsYRVELVMegdvdpktgfvddfFNIEQYFSPLLEKLDHHCLNeieelenptaenIAIWIWKRLSTSLSILSSVRVyetpmswveyqgf
mkitqaftfeaahrlprvpkthkchRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSilssvrvyetpmswveyqgf
MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF
MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF
MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF
MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF
MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF
MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target118 hypothetical protein CLIBASIA_04670 [Candidatus Liberib
315122372118 hypothetical protein CKC_03120 [Candidatus Liberibacter 1 8e-59
158422695118 hypothetical protein AZC_1071 [Azorhizobium caulinodans 1 4e-47
170748386118 queuosine biosynthesis protein QueD [Methylobacterium r 1 3e-46
188580424118 queuosine biosynthesis protein QueD [Methylobacterium p 1 4e-46
163850655118 queuosine biosynthesis protein QueD [Methylobacterium e 1 4e-46
46203558118 COG0720: 6-pyruvoyl-tetrahydropterin synthase [Magnetos 1 2e-45
170744630118 queuosine biosynthesis protein QueD [Methylobacterium s 1 3e-45
91975957122 putative 6-pyruvoyl tetrahydropterin synthase [Rhodopse 1 2e-44
220926505118 queuosine biosynthesis protein QueD [Methylobacterium n 1 2e-43
13474944117 hypothetical protein mll8751 [Mesorhizobium loti MAFF30 1 2e-43
>gi|315122372|ref|YP_004062861.1| hypothetical protein CKC_03120 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 118 Back     alignment and organism information
 Score =  229 bits (585), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 106/117 (90%), Positives = 113/117 (96%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAH+LP VPKTHKC+RMHGHSYRVELVMEGDVDPKTGFVDDFFNIE+YF+
Sbjct: 1   MKITQAFTFEAAHKLPYVPKTHKCYRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEKYFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLLEKLDHHCLNE+E+L+NPTAENIAIWIWKRL  SL ILSSVRVYETPMSWVEYQG
Sbjct: 61  PLLEKLDHHCLNEVEDLDNPTAENIAIWIWKRLFDSLPILSSVRVYETPMSWVEYQG 117


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|158422695|ref|YP_001523987.1| hypothetical protein AZC_1071 [Azorhizobium caulinodans ORS 571] Length = 118 Back     alignment and organism information
>gi|170748386|ref|YP_001754646.1| queuosine biosynthesis protein QueD [Methylobacterium radiotolerans JCM 2831] Length = 118 Back     alignment and organism information
>gi|188580424|ref|YP_001923869.1| queuosine biosynthesis protein QueD [Methylobacterium populi BJ001] Length = 118 Back     alignment and organism information
>gi|163850655|ref|YP_001638698.1| queuosine biosynthesis protein QueD [Methylobacterium extorquens PA1] Length = 118 Back     alignment and organism information
>gi|46203558|ref|ZP_00209017.1| COG0720: 6-pyruvoyl-tetrahydropterin synthase [Magnetospirillum magnetotacticum MS-1] Length = 118 Back     alignment and organism information
>gi|170744630|ref|YP_001773285.1| queuosine biosynthesis protein QueD [Methylobacterium sp. 4-46] Length = 118 Back     alignment and organism information
>gi|91975957|ref|YP_568616.1| putative 6-pyruvoyl tetrahydropterin synthase [Rhodopseudomonas palustris BisB5] Length = 122 Back     alignment and organism information
>gi|220926505|ref|YP_002501807.1| queuosine biosynthesis protein QueD [Methylobacterium nodulans ORS 2060] Length = 118 Back     alignment and organism information
>gi|13474944|ref|NP_106514.1| hypothetical protein mll8751 [Mesorhizobium loti MAFF303099] Length = 117 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target118 hypothetical protein CLIBASIA_04670 [Candidatus Liberib
TIGR0336792 TIGR03367, queuosine_QueD, queuosine biosynthesis prote 1e-28
COG0720127 COG0720, COG0720, 6-pyruvoyl-tetrahydropterin synthase 2e-24
TIGR00039124 TIGR00039, 6PTHBS, 6-pyruvoyl tetrahydropterin synthase 7e-23
cd00470135 cd00470, PTPS, 6-pyruvoyl tetrahydropterin synthase (PT 9e-23
KOG4105141 KOG4105, KOG4105, KOG4105, 6-pyruvoyl tetrahydrobiopter 5e-13
pfam01242120 pfam01242, PTPS, 6-pyruvoyl tetrahydropterin synthase 9e-36
>gnl|CDD|163236 TIGR03367, queuosine_QueD, queuosine biosynthesis protein QueD Back     alignment and domain information
>gnl|CDD|31064 COG0720, COG0720, 6-pyruvoyl-tetrahydropterin synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|161674 TIGR00039, 6PTHBS, 6-pyruvoyl tetrahydropterin synthase/QueD family protein Back     alignment and domain information
>gnl|CDD|29761 cd00470, PTPS, 6-pyruvoyl tetrahydropterin synthase (PTPS) Back     alignment and domain information
>gnl|CDD|39308 KOG4105, KOG4105, KOG4105, 6-pyruvoyl tetrahydrobiopterin synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|144727 pfam01242, PTPS, 6-pyruvoyl tetrahydropterin synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 118 hypothetical protein CLIBASIA_04670 [Candidatus Liberib
cd00470135 PTPS 6-pyruvoyl tetrahydropterin synthase (PTPS). Folat 100.0
pfam01242120 PTPS 6-pyruvoyl tetrahydropterin synthase. 6-Pyruvoyl t 100.0
COG0720127 6-pyruvoyl-tetrahydropterin synthase [Coenzyme metaboli 100.0
TIGR0336792 queuosine_QueD queuosine biosynthesis protein QueD. Mem 100.0
TIGR00039153 6PTHBS putative 6-pyruvoyl tetrahydropterin synthase; I 100.0
TIGR03112113 6_pyr_pter_rel 6-pyruvoyl tetrahydropterin synthase-rel 100.0
KOG4105141 consensus 99.95
>cd00470 PTPS 6-pyruvoyl tetrahydropterin synthase (PTPS) Back     alignment and domain information
>pfam01242 PTPS 6-pyruvoyl tetrahydropterin synthase Back     alignment and domain information
>COG0720 6-pyruvoyl-tetrahydropterin synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03367 queuosine_QueD queuosine biosynthesis protein QueD Back     alignment and domain information
>TIGR00039 6PTHBS putative 6-pyruvoyl tetrahydropterin synthase; InterPro: IPR007116 The complex organic chemistry involved in the transformation of GTP to tetrahydrobiopterin is catalysed by only three enzymes: GTP cyclohydrolase I, 6-pyruvoyltetrahydropterin synthase and sepiapterin reductase Back     alignment and domain information
>TIGR03112 6_pyr_pter_rel 6-pyruvoyl tetrahydropterin synthase-related domain Back     alignment and domain information
>KOG4105 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target118 hypothetical protein CLIBASIA_04670 [Candidatus Liberib
2oba_A138 Pseudomonas Aeruginosa 6-Pyruvoyl Tetrahydrobiopter 2e-36
3i2b_A141 The Crystal Structure Of Human 6 Pyruvoyl Tetrahydr 7e-26
1gtq_A140 6-Pyruvoyl Tetrahydropterin Synthase Length = 140 4e-23
2g64_A140 Structure Of Caenorhabditis Elegans 6-Pyruvoyl Tetr 3e-19
2dj6_A115 Crystal Structure Of 6-Pyruvoyl Tetrahydrobiopterin 8e-16
3d7j_A152 Sco6650, A 6-Pyruvoyltetrahydropterin Synthase Homo 2e-12
1y13_A181 Structural Analysis Of Plasmodium Falciparum 6-Pyru 9e-05
3jyg_A188 Crystal Structure Of Uncharacterized Protein Ws1659 6e-05
3m0n_A180 Plasmodium Vivax 6-Pyruvoyltetrahydropterin Synthas 2e-04
2a0s_A180 Crystal Structure Of 6-Pyruvoyl Tetrahydropterin Sy 2e-04
3lze_A180 Plasmodium Vivax 6-Pyruvoyltetrahydropterin Synthas 4e-04
>gi|126031480|pdb|2OBA|A Chain A, Pseudomonas Aeruginosa 6-Pyruvoyl Tetrahydrobiopterin Synthase Length = 138 Back     alignment and structure
 Score =  154 bits (391), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 86/116 (74%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + FTFE+AHRLP VP+ HKC R+HGHS+RV + +EG+VDP TG++ DF  I+  F P
Sbjct: 22  ELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKP 81

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + E+LDH+ LN+I  LENPT+EN+  WIW++L   L  LS VRV+ET  S  EY+G
Sbjct: 82  IYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG 137


>gi|254839597|pdb|3I2B|A Chain A, The Crystal Structure Of Human 6 Pyruvoyl Tetrahydrobiopterin Synthase Length = 141 Back     alignment and structure
>gi|1421148|pdb|1GTQ|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase Length = 140 Back     alignment and structure
>gi|93279885|pdb|2G64|A Chain A, Structure Of Caenorhabditis Elegans 6-Pyruvoyl Tetrahydropterin Synthase Length = 140 Back     alignment and structure
gi|116667076|pdb|2DJ6|A Chain A, Crystal Structure Of 6-Pyruvoyl Tetrahydrobiopterin Synthase From Pyrococcus Horikoshii Ot3 Length = 115 Back     alignment and structure
>gi|209870445|pdb|3D7J|A Chain A, Sco6650, A 6-Pyruvoyltetrahydropterin Synthase Homolog From Streptomyces Coelicolor Length = 152 Back     alignment and structure
>gi|61679429|pdb|1Y13|A Chain A, Structural Analysis Of Plasmodium Falciparum 6-Pyruvoyl Tetrahydropterin Synthase (Ptps) Length = 181 Back     alignment and structure
>gi|261278866|pdb|3JYG|A Chain A, Crystal Structure Of Uncharacterized Protein Ws1659 From Wolinella Succinogenes Length = 188 Back     alignment and structure
>gi|293652005|pdb|3M0N|A Chain A, Plasmodium Vivax 6-Pyruvoyltetrahydropterin Synthase (Ptps), E37a Catalytic Residue Mutant Length = 180 Back     alignment and structure
>gi|73536047|pdb|2A0S|A Chain A, Crystal Structure Of 6-Pyruvoyl Tetrahydropterin Synthase (Ptps) From Plasmodium Vivax At 2.2 A Resolution Length = 180 Back     alignment and structure
>gi|293652000|pdb|3LZE|A Chain A, Plasmodium Vivax 6-Pyruvoyltetrahydropterin Synthase (Ptps), E37c Catalytic Residue Mutant Length = 180 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target118 hypothetical protein CLIBASIA_04670 [Candidatus Liberib
2oba_A138 Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetra 1e-36
1b66_A140 6-pyruvoyl tetrahydropterin synthase; tetrahydrobiopter 3e-29
2g64_A140 Putative 6-pyruvoyl tetrahydrobiopterin synthase; tetra 1e-28
2dj6_A115 Hypothetical protein PH0634; 6-pyruvoyl tetrahydrobiopt 5e-26
3d7j_A152 Uncharacterized protein SCO6650; T-fold, unknown functi 1e-23
1y13_A181 PTPS, 6-pyruvoyl tetrahydropterin synthase; structural 6e-23
3lx3_A180 6-pyruvoyl tetrahydrobiopterin synthase; PTS, PTP synth 2e-22
2a0s_A180 6-pyruvoyl tetrahydropterin synthase; SGPP, structural 3e-21
3jyg_A188 Uncharacterized protein; structural genomics, unknown f 4e-21
>2oba_A Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, PTP synthase, PTPS, lyase; 2.33A {Pseudomonas aeruginosa} Length = 138 Back     alignment and structure
 Score =  146 bits (369), Expect = 1e-36
 Identities = 64/117 (54%), Positives = 87/117 (74%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + FTFE+AHRLP VP+ HKC R+HGHS+RV + +EG+VDP TG++ DF  I+  F 
Sbjct: 21  MELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFK 80

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDH+ LN+I  LENPT+EN+  WIW++L   L  LS VRV+ET  S  EY+G
Sbjct: 81  PIYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG 137


>1b66_A 6-pyruvoyl tetrahydropterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; HET: BIO; 1.90A {Rattus rattus} SCOP: d.96.1.2 PDB: 1b6z_A 1gtq_A 3i2b_A Length = 140 Back     alignment and structure
>2g64_A Putative 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; 1.80A {Caenorhabditis elegans} SCOP: d.96.1.2 Length = 140 Back     alignment and structure
>2dj6_A Hypothetical protein PH0634; 6-pyruvoyl tetrahydrobiopterin synthase (PTPS), X-RAY diffraction, structural genomics, NPPSFA; 2.10A {Pyrococcus horikoshii OT3} PDB: 2dtt_A* Length = 115 Back     alignment and structure
>3d7j_A Uncharacterized protein SCO6650; T-fold, unknown function; 1.45A {Streptomyces coelicolor} Length = 152 Back     alignment and structure
>1y13_A PTPS, 6-pyruvoyl tetrahydropterin synthase; structural genomics of pathogenic protozoa consortium, SGPP, structural genomics, PSI; HET: BIO; 2.20A {Plasmodium falciparum} SCOP: d.96.1.2 Length = 181 Back     alignment and structure
>3lx3_A 6-pyruvoyl tetrahydrobiopterin synthase; PTS, PTP synthase, PTPS, metal-binding, tetrahydrobiopterin biosynthesis, folate biosynthesis; HET: XTN; 1.55A {Plasmodium vivax} PDB: 2a0s_A* 3m0n_A* 3lze_A* Length = 180 Back     alignment and structure
>2a0s_A 6-pyruvoyl tetrahydropterin synthase; SGPP, structural genomics, PSI, protein structure initiative, PTPS; HET: BIO; 2.20A {Plasmodium vivax} SCOP: d.96.1.2 Length = 180 Back     alignment and structure
>3jyg_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.95A {Wolinella succinogenes} Length = 188 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target118 hypothetical protein CLIBASIA_04670 [Candidatus Liberib
2oba_A138 Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetra 100.0
2g64_A140 Putative 6-pyruvoyl tetrahydrobiopterin synthase; tetra 100.0
1b66_A140 6-pyruvoyl tetrahydropterin synthase; tetrahydrobiopter 100.0
3d7j_A152 Uncharacterized protein SCO6650; T-fold, unknown functi 100.0
2dj6_A115 Hypothetical protein PH0634; 6-pyruvoyl tetrahydrobiopt 100.0
3jyg_A188 Uncharacterized protein; structural genomics, unknown f 100.0
1y13_A181 PTPS, 6-pyruvoyl tetrahydropterin synthase; structural 100.0
3lx3_A180 6-pyruvoyl tetrahydrobiopterin synthase; PTS, PTP synth 100.0
>2oba_A Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, PTP synthase, PTPS, lyase; 2.33A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=100.00  E-value=0  Score=280.27  Aligned_cols=117  Identities=55%  Similarity=0.984  Sum_probs=115.2

Q ss_pred             CEEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             97999999971212279998776356767348999999933688754886299999999888775313320335543366
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENP   80 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~~nP   80 (118)
                      |+|+|+|+|+|||||++.+.++||+++|||||+|+|+++|+.+++.|||+||++||+++++++++|||++||++++|+||
T Consensus        21 m~I~k~~~F~AAH~l~~~~~~~kC~~lHGHsy~v~v~v~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~~~P  100 (138)
T 2oba_A           21 MELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKPIYEQLDHNYLNDIPGLENP  100 (138)
T ss_dssp             EEEEEEEEEEEEECCSSSCTTCGGGSSEEEEEEEEEEEEECCCTTTSSSSCHHHHHHHHHHHHHHHTTSBGGGSTTCSSC
T ss_pred             EEEEEEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCEEEEHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             99999999981649689999997478728938999999950479888787199999999986765676233567354577


Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEC
Q ss_conf             5568999999999851142127999985995599750
Q gi|254781032|r   81 TAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        81 T~Enia~~i~~~l~~~l~~l~~V~v~Et~~~~a~Y~G  117 (118)
                      |+||||+|||+++++++|+|.+|+|||||++||+|+|
T Consensus       101 T~Enia~~i~~~l~~~l~~l~~V~v~Et~~~~a~Y~g  137 (138)
T 2oba_A          101 TSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG  137 (138)
T ss_dssp             CHHHHHHHHHHHHGGGCTTEEEEEEESSTTEEEEECC
T ss_pred             CHHHHHHHHHHHHHHHCCCEEEEEEEECCCCEEEEEC
T ss_conf             9899999999998873177059999978998899958



>2g64_A Putative 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; 1.80A {Caenorhabditis elegans} SCOP: d.96.1.2 Back     alignment and structure
>1b66_A 6-pyruvoyl tetrahydropterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; HET: BIO; 1.90A {Rattus rattus} SCOP: d.96.1.2 PDB: 1b6z_A 1gtq_A 3i2b_A Back     alignment and structure
>3d7j_A Uncharacterized protein SCO6650; T-fold, unknown function; 1.45A {Streptomyces coelicolor} Back     alignment and structure
>2dj6_A Hypothetical protein PH0634; 6-pyruvoyl tetrahydrobiopterin synthase (PTPS), X-RAY diffraction, structural genomics, NPPSFA; 2.10A {Pyrococcus horikoshii OT3} PDB: 2dtt_A* Back     alignment and structure
>3jyg_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.95A {Wolinella succinogenes} Back     alignment and structure
>1y13_A PTPS, 6-pyruvoyl tetrahydropterin synthase; structural genomics of pathogenic protozoa consortium, SGPP, structural genomics, PSI; HET: BIO; 2.20A {Plasmodium falciparum} SCOP: d.96.1.2 Back     alignment and structure
>3lx3_A 6-pyruvoyl tetrahydrobiopterin synthase; PTS, PTP synthase, PTPS, metal-binding, tetrahydrobiopterin biosynthesis, folate biosynthesis; HET: XTN; 1.55A {Plasmodium vivax} PDB: 2a0s_A* 3m0n_A* 3lze_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 118 hypothetical protein CLIBASIA_04670 [Candidatus Liberib
d2g64a1139 d.96.1.2 (A:1-139) 6-pyruvoyl tetrahydropterin synthase 6e-29
d1b66a_138 d.96.1.2 (A:) 6-pyruvoyl tetrahydropterin synthase {Rat 2e-27
d2a0sa1163 d.96.1.2 (A:18-180) 6-pyruvoyl tetrahydropterin synthas 8e-21
>d2g64a1 d.96.1.2 (A:1-139) 6-pyruvoyl tetrahydropterin synthase {Caenorhabditis elegans [TaxId: 6239]} Length = 139 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: T-fold
superfamily: Tetrahydrobiopterin biosynthesis enzymes-like
family: 6-pyruvoyl tetrahydropterin synthase
domain: 6-pyruvoyl tetrahydropterin synthase
species: Caenorhabditis elegans [TaxId: 6239]
 Score =  119 bits (300), Expect = 6e-29
 Identities = 39/133 (29%), Positives = 73/133 (54%), Gaps = 16/133 (12%)

Query: 1   MKITQAFTFEAAHRLPR--------VPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVD 50
           + + +  +F AAHRL               KC+    HGH+Y  ++ + G+VDP +G V 
Sbjct: 7   VTMERVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMVY 66

Query: 51  DFFNIEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS---ILSSVR 104
           D   +++  S +L+ +DH  L+ ++E  +    T+EN+AI+++++L + +S   +L  V 
Sbjct: 67  DLAKLKKEMSLVLDTVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVT 126

Query: 105 VYETPMSWVEYQG 117
           + ETP +   Y+G
Sbjct: 127 IEETPKNIFTYKG 139


>d1b66a_ d.96.1.2 (A:) 6-pyruvoyl tetrahydropterin synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d2a0sa1 d.96.1.2 (A:18-180) 6-pyruvoyl tetrahydropterin synthase {Plasmodium vivax [TaxId: 5855]} Length = 163 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target118 hypothetical protein CLIBASIA_04670 [Candidatus Liberib
d1b66a_138 6-pyruvoyl tetrahydropterin synthase {Rat (Rattus norve 100.0
d2g64a1139 6-pyruvoyl tetrahydropterin synthase {Caenorhabditis el 100.0
d2a0sa1163 6-pyruvoyl tetrahydropterin synthase {Plasmodium vivax 100.0
>d1b66a_ d.96.1.2 (A:) 6-pyruvoyl tetrahydropterin synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: T-fold
superfamily: Tetrahydrobiopterin biosynthesis enzymes-like
family: 6-pyruvoyl tetrahydropterin synthase
domain: 6-pyruvoyl tetrahydropterin synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=2.8e-45  Score=260.27  Aligned_cols=117  Identities=34%  Similarity=0.721  Sum_probs=109.3

Q ss_pred             CEEEEEEEEECCEECCCCCCC--------CCCCCC--CCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHH-HHHHHHHHH
Q ss_conf             979999999712122799987--------763567--673489999999336887548862999999998-887753133
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS-PLLEKLDHH   69 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~~--------~kc~~l--HGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~-~i~~~lDH~   69 (118)
                      ++|||+++|+|||||++++++        |||+++  |||||+|+|+++|+.+++.|||+||++||++++ +|+++|||+
T Consensus         5 ~~ltr~~~F~AaHrl~~~~~s~~~n~~~~GkC~~~~~HGH~y~veV~v~g~~~~~~G~v~Df~~lk~~~~~~I~~~lDH~   84 (138)
T d1b66a_           5 ARLSRLVSFSASHRLHSPSLSAEENLKVFGKCNNPNGHGHNYKVVVTIHGEIDPVTGMVMNLTDLKEYMEEAIMKPLDHK   84 (138)
T ss_dssp             EEEEEEEEEEEEECCCCTTSCHHHHHHHHGGGGCTTCEEEEEEEEEEEEEECCTTTCCSSCHHHHHHHHHHHTHHHHTTE
T ss_pred             EEEEEEEEEECCCCCCCCCCCHHHCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCEEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999982448279877811243135767887788877999999996217767748777999999998354165221


Q ss_pred             HCC-CCCCCC--CCCHHHHHHHHHHHHHHHCCC--CEEEEEEECCCCEEEEEC
Q ss_conf             203-355433--665568999999999851142--127999985995599750
Q gi|254781032|r   70 CLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        70 ~Ln-d~~~~~--nPT~Enia~~i~~~l~~~l~~--l~~V~v~Et~~~~a~Y~G  117 (118)
                      +|| ++|+|.  |||+||||+|||++|++.+|.  |.+|+|||||++||+|+|
T Consensus        85 ~Ln~~~p~~~~~~PTaEniA~~i~~~l~~~l~~~~l~~V~v~ET~~~~a~Y~g  137 (138)
T d1b66a_          85 NLDLDVPYFADVVSTTENVAVYIWENLQRLLPVGALYKVKVYETDNNIVVYKG  137 (138)
T ss_dssp             EHHHHCGGGTSSCCCHHHHHHHHHHHHHHHSCTTCEEEEEEEEETTEEEEECC
T ss_pred             HCCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCEEEEEC
T ss_conf             10466765526785099999999999985488363579999978998899927



>d2g64a1 d.96.1.2 (A:1-139) 6-pyruvoyl tetrahydropterin synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a0sa1 d.96.1.2 (A:18-180) 6-pyruvoyl tetrahydropterin synthase {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 118 hypothetical protein CLIBASIA_04670 [Candidatus Li
2oba_A_138 (A:) Probable 6-pyruvoyl tetrahydrobiopterin synth 9e-37
3d7j_A_152 (A:) Uncharacterized protein SCO6650; T-fold, unkn 7e-30
2dj6_A_115 (A:) Hypothetical protein PH0634; 6-pyruvoyl tetra 4e-29
2g64_A_140 (A:) Putative 6-pyruvoyl tetrahydrobiopterin synth 2e-27
1b66_A_140 (A:) 6-pyruvoyl tetrahydropterin synthase; tetrahy 3e-27
2a0s_A_180 (A:) 6-pyruvoyl tetrahydropterin synthase; SGPP, s 1e-23
3jyg_A_188 (A:) Uncharacterized protein; structural genomics, 4e-23
1y13_A_181 (A:) PTPS, 6-pyruvoyl tetrahydropterin synthase; s 4e-22
>2oba_A (A:) Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, PTP synthase, PTPS, lyase; 2.33A {Pseudomonas aeruginosa}Length = 138 Back     alignment and structure
 Score =  146 bits (370), Expect = 9e-37
 Identities = 63/116 (54%), Positives = 86/116 (74%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + FTFE+AHRLP VP+ HKC R+HGHS+RV + +EG+VDP TG++ DF  I+  F P
Sbjct: 22  ELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKP 81

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + E+LDH+ LN+I  LENPT+EN+  WIW++L   L  LS VRV+ET  S  EY+G
Sbjct: 82  IYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG 137


>3d7j_A (A:) Uncharacterized protein SCO6650; T-fold, unknown function; 1.45A {Streptomyces coelicolor}Length = 152 Back     alignment and structure
>2dj6_A (A:) Hypothetical protein PH0634; 6-pyruvoyl tetrahydrobiopterin synthase (PTPS), X-RAY diffraction, structural genomics, NPPSFA; 2.10A {Pyrococcus horikoshii OT3} PDB: 2dtt_A*Length = 115 Back     alignment and structure
>2g64_A (A:) Putative 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; 1.80A {Caenorhabditis elegans}Length = 140 Back     alignment and structure
>1b66_A (A:) 6-pyruvoyl tetrahydropterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; HET: BIO; 1.90A {Rattus rattus}Length = 140 Back     alignment and structure
>2a0s_A (A:) 6-pyruvoyl tetrahydropterin synthase; SGPP, structural genomics, PSI, protein structure initiative, PTPS; HET: BIO; 2.20A {Plasmodium vivax}Length = 180 Back     alignment and structure
>3jyg_A (A:) Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.95A {Wolinella succinogenes}Length = 188 Back     alignment and structure
>1y13_A (A:) PTPS, 6-pyruvoyl tetrahydropterin synthase; structural genomics of pathogenic protozoa consortium, SGPP, structural genomics, PSI; HET: BIO; 2.20A {Plasmodium falciparum}Length = 181 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target118 hypothetical protein CLIBASIA_04670 [Candidatus Liberib
2oba_A_138 Probable 6-pyruvoyl tetrahydrobiopterin synthase; 100.0
3d7j_A_152 Uncharacterized protein SCO6650; T-fold, unknown f 100.0
2g64_A_140 Putative 6-pyruvoyl tetrahydrobiopterin synthase; 100.0
1b66_A_140 6-pyruvoyl tetrahydropterin synthase; tetrahydrobi 100.0
2dj6_A_115 Hypothetical protein PH0634; 6-pyruvoyl tetrahydro 100.0
3jyg_A_188 Uncharacterized protein; structural genomics, unkn 100.0
2a0s_A_180 6-pyruvoyl tetrahydropterin synthase; SGPP, struct 100.0
1y13_A_181 PTPS, 6-pyruvoyl tetrahydropterin synthase; struct 100.0
3jyg_A_188 Uncharacterized protein; structural genomics, unkn 93.99
>2oba_A (A:) Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, PTP synthase, PTPS, lyase; 2.33A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=100.00  E-value=5.7e-44  Score=255.69  Aligned_cols=116  Identities=54%  Similarity=0.980  Sum_probs=113.6

Q ss_pred             EEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             79999999712122799987763567673489999999336887548862999999998887753133203355433665
Q gi|254781032|r    2 KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPT   81 (118)
Q Consensus         2 ~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~~nPT   81 (118)
                      +|+|+++|+|||+|++++..|||+++|||||+|+|+++|+.+++.|||+||+++|++++.++++|||++||+++++.|||
T Consensus        22 ~i~~~~~F~aAH~l~~~~~~g~c~~lHGHty~v~v~i~~~~l~~~g~vvDf~~lk~~~~~v~~~lDh~~L~~~~~~~~pT  101 (138)
T 2oba_A           22 ELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKPIYEQLDHNYLNDIPGLENPT  101 (138)
T ss_dssp             EEEEEEEEEEEECCSSSCTTCGGGSSEEEEEEEEEEEEECCCTTTSSSSCHHHHHHHHHHHHHHHTTSBGGGSTTCSSCC
T ss_pred             EEEEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEECCCCCEEEEHHHHHHHHHHHHHHCCHHHHCCCCCCCCCC
T ss_conf             99999999727596899999975787088089999999766688874854999878898766330203215662211338


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEC
Q ss_conf             568999999999851142127999985995599750
Q gi|254781032|r   82 AENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        82 ~Enia~~i~~~l~~~l~~l~~V~v~Et~~~~a~Y~G  117 (118)
                      +||||+|||+++++++|++.+|+|||||++||+|+|
T Consensus       102 ~E~la~~i~~~l~~~l~~l~~V~v~Et~~~~A~y~~  137 (138)
T 2oba_A          102 SENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG  137 (138)
T ss_dssp             HHHHHHHHHHHHGGGCTTEEEEEEESSTTEEEEECC
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEC
T ss_conf             899999999998874266228999978998899958



>3d7j_A (A:) Uncharacterized protein SCO6650; T-fold, unknown function; 1.45A {Streptomyces coelicolor} Back     alignment and structure
>2g64_A (A:) Putative 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; 1.80A {Caenorhabditis elegans} Back     alignment and structure
>1b66_A (A:) 6-pyruvoyl tetrahydropterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; HET: BIO; 1.90A {Rattus rattus} Back     alignment and structure
>2dj6_A (A:) Hypothetical protein PH0634; 6-pyruvoyl tetrahydrobiopterin synthase (PTPS), X-RAY diffraction, structural genomics, NPPSFA; 2.10A {Pyrococcus horikoshii OT3} PDB: 2dtt_A* Back     alignment and structure
>3jyg_A (A:) Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.95A {Wolinella succinogenes} Back     alignment and structure
>2a0s_A (A:) 6-pyruvoyl tetrahydropterin synthase; SGPP, structural genomics, PSI, protein structure initiative, PTPS; HET: BIO; 2.20A {Plasmodium vivax} Back     alignment and structure
>1y13_A (A:) PTPS, 6-pyruvoyl tetrahydropterin synthase; structural genomics of pathogenic protozoa consortium, SGPP, structural genomics, PSI; HET: BIO; 2.20A {Plasmodium falciparum} Back     alignment and structure
>3jyg_A (A:) Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.95A {Wolinella succinogenes} Back     alignment and structure