254781038

254781038

putative DNA-binding/iron metalloprotein/AP endonuclease

GeneID in NCBI database:8210061Locus tag:CLIBASIA_04700
Protein GI in NCBI database:254781038Protein Accession:YP_003065451.1
Gene range:+(1041348, 1042439)Protein Length:363aa
Gene description:putative DNA-binding/iron metalloprotein/AP endonuclease
COG prediction:[O] Metal-dependent proteases with possible chaperone activity
KEGG prediction:gcp; putative DNA-binding/iron metalloprotein/AP endonuclease; K01409 O-sialoglycoprotein endopeptidase [EC:3.4.24.57]
SEED prediction:YgjD/Kae1/Qri7 family, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial RNA-metabolizing Zn-dependent hydrolases;
Conserved gene cluster associated with Met-tRNA formyltransferase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MSKIKKTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEKAPSKIGSGKRGVKA
ccccccEEEEEEcccHHHEEEEEEccccccEEEEHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHcccccccEEEEEEccccEEEEEEccccccEEEHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccccccccccccccccEEEEHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHcccEEEEccHHHccHHHHHHHHHHHHHHHccccccccccccccccccHHcccHHHHcccccccc
ccHHccEEEEEEccccccEEEEEEcccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHcHEEEcccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccHccccccccEEEEEEcccccEEEEEcccccEEEccccHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHccccccccccccccc
MSKIKKTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIdqhghyggvvpEVAARAHVDVLDILIKQTLLRANmqisdmdsiavtagpglmGGLIVGLMTAKAIsyvshkpfyainHLEGHILTarltddiafPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKslglpypggveIEKAalmgdgkrfkfpcplvqgtlcdfsfsglktsvQKTICAFDVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVlhgfrfvapparlctdNAVMIAWAALERMeaglpaddlsisprsrwpldekapskigsgkrgvka
mskikktvigietscdetaVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKslglpypgGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALERMEAGLPADdlsisprsrwpldekapskigsgkrgvka
MSKIKKTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEKAPSKIGSGKRGVKA
****KKT*IGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICA*****KQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEKAP************
MSKIKKTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEK**************
**KIKKTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEKA*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKIKKTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEKAPSKIGSGKRGVKA
MSKIKKTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEKAPSKIGSGKRGVKA
MSKIKKTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEKAPSKIGSGKRGVKA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target363 putative DNA-binding/iron metalloprotein/AP endonucleas
254780429206 hypothetical protein CLIBASIA_01570 [Candidatus Li 3e-04
>gi|254780429|ref|YP_003064842.1| hypothetical protein CLIBASIA_01570 [Candidatus Liberibacter asiaticus str. psy62] Length = 206 Back     alignment
 Score = 37.7 bits (86), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 56  ARAHVDVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFY 115
            R H + L   I   L  + +++S +D +    GPG   G+ V +  A+ IS V  +P  
Sbjct: 34  GRGHAEHLMPAIDYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPAL 93

Query: 116 AINHLEGHILTARLTDDIAFPYLVLL 141
            + +LE  +  A L   +  P +VL+
Sbjct: 94  GVGNLE-VLARAHLDSHVGRPIMVLV 118

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target363 putative DNA-binding/iron metalloprotein/AP endonucleas
315122377363 putative DNA-binding/iron metalloprotein/AP endonucleas 1 1e-175
227823725364 putative DNA-binding/iron metalloprotein/AP endonucleas 1 1e-125
15966831360 O-sialoglycoprotein endopeptidase [Sinorhizobium melilo 1 1e-124
222150054365 putative DNA-binding/iron metalloprotein/AP endonucleas 1 1e-124
307301659365 metalloendopeptidase, glycoprotease family [Sinorhizobi 1 1e-124
150398162360 putative DNA-binding/iron metalloprotein/AP endonucleas 1 1e-122
161619805359 O-sialoglycoprotein endopeptidase [Brucella canis ATCC 1 1e-118
62290745359 putative DNA-binding/iron metalloprotein/AP endonucleas 1 1e-118
17986459359 putative DNA-binding/iron metalloprotein/AP endonucleas 1 1e-118
148560729359 putative DNA-binding/iron metalloprotein/AP endonucleas 1 1e-118
>gi|315122377|ref|YP_004062866.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 363 Back     alignment and organism information
 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 302/363 (83%), Positives = 325/363 (89%)

Query: 1   MSKIKKTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHV 60
           M K++KTVIGIETSCDETAVAVVRR+    +ILAE +LSQIDQHG YGGVVPE+AARAHV
Sbjct: 1   MFKVQKTVIGIETSCDETAVAVVRREGFQNKILAEVILSQIDQHGEYGGVVPEIAARAHV 60

Query: 61  DVLDILIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHL 120
           D LD+LIK+TL RA+MQISD+DSIAVTAGPGLMGGLIVGLMTAKAISY S KPFYAINHL
Sbjct: 61  DSLDVLIKKTLSRASMQISDIDSIAVTAGPGLMGGLIVGLMTAKAISYASQKPFYAINHL 120

Query: 121 EGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSL 180
           EGHILTARLTD + FPYLVLLVSGGHTQILLVR VA YDRLGTTIDDALGECFDKIAKSL
Sbjct: 121 EGHILTARLTDGVNFPYLVLLVSGGHTQILLVRGVARYDRLGTTIDDALGECFDKIAKSL 180

Query: 181 GLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDI 240
           G  YPGG  IEKAAL G+G+RF FPCP VQG  CDFSFSGLKTSVQ+ I +FDVLEKQDI
Sbjct: 181 GFSYPGGAAIEKAALKGNGQRFNFPCPSVQGMCCDFSFSGLKTSVQQKIRSFDVLEKQDI 240

Query: 241 ADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLH 300
           ADICASFQVTV+RIL+ +L+QGFLLF+K FP+K+ VLVVSGGVASN FIRA+LIDLC   
Sbjct: 241 ADICASFQVTVIRILRKKLEQGFLLFQKEFPNKKPVLVVSGGVASNSFIRAALIDLCTSK 300

Query: 301 GFRFVAPPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEKAPSKIGSGKRG 360
           GF FVAPPARLCTDNAVMIAWAALERMEAG P DDLSISPRSRWPLDEKA SKIGSGKRG
Sbjct: 301 GFCFVAPPARLCTDNAVMIAWAALERMEAGFPPDDLSISPRSRWPLDEKALSKIGSGKRG 360

Query: 361 VKA 363
            KA
Sbjct: 361 AKA 363


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823725|ref|YP_002827698.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Sinorhizobium fredii NGR234] Length = 364 Back     alignment and organism information
>gi|15966831|ref|NP_387184.1| O-sialoglycoprotein endopeptidase [Sinorhizobium meliloti 1021] Length = 360 Back     alignment and organism information
>gi|222150054|ref|YP_002551011.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Agrobacterium vitis S4] Length = 365 Back     alignment and organism information
>gi|307301659|ref|ZP_07581418.1| metalloendopeptidase, glycoprotease family [Sinorhizobium meliloti BL225C] Length = 365 Back     alignment and organism information
>gi|150398162|ref|YP_001328629.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Sinorhizobium medicae WSM419] Length = 360 Back     alignment and organism information
>gi|161619805|ref|YP_001593692.1| O-sialoglycoprotein endopeptidase [Brucella canis ATCC 23365] Length = 359 Back     alignment and organism information
>gi|62290745|ref|YP_222538.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Brucella abortus bv. 1 str. 9-941] Length = 359 Back     alignment and organism information
>gi|17986459|ref|NP_539093.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Brucella melitensis bv. 1 str. 16M] Length = 359 Back     alignment and organism information
>gi|148560729|ref|YP_001259713.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Brucella ovis ATCC 25840] Length = 359 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target363 putative DNA-binding/iron metalloprotein/AP endonucleas
PRK09604332 PRK09604, PRK09604, UGMP family protein; Validated 1e-136
TIGR03723314 TIGR03723, bact_gcp, putative glycoprotease GCP 1e-125
KOG2707405 KOG2707, KOG2707, KOG2707, Predicted metalloprotease wi 1e-81
TIGR03722322 TIGR03722, arch_KAE1, universal archaeal protein Kae1 7e-46
PRK14878323 PRK14878, PRK14878, UGMP family protein; Provisional 5e-44
PRK09605 535 PRK09605, PRK09605, bifunctional UGMP family protein/se 6e-43
KOG2708336 KOG2708, KOG2708, KOG2708, Predicted metalloprotease wi 9e-37
PTZ00340345 PTZ00340, PTZ00340, O-sialoglycoprotein endopeptidase-l 8e-35
COG0533342 COG0533, QRI7, Metal-dependent proteases with possible 1e-113
TIGR00329305 TIGR00329, gcp_kae1, metallohydrolase, glycoprotease/Ka 8e-86
pfam00814225 pfam00814, Peptidase_M22, Glycoprotease family 8e-56
TIGR03725202 TIGR03725, bact_YeaZ, universal bacterial protein YeaZ 4e-09
COG1214220 COG1214, COG1214, Inactive homolog of metal-dependent p 9e-08
COG0068750 COG0068, HypF, Hydrogenase maturation factor [Posttrans 0.004
>gnl|CDD|181984 PRK09604, PRK09604, UGMP family protein; Validated Back     alignment and domain information
>gnl|CDD|163435 TIGR03723, bact_gcp, putative glycoprotease GCP Back     alignment and domain information
>gnl|CDD|37918 KOG2707, KOG2707, KOG2707, Predicted metalloprotease with chaperone activity (RNAse H/HSP70 fold) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163434 TIGR03722, arch_KAE1, universal archaeal protein Kae1 Back     alignment and domain information
>gnl|CDD|184878 PRK14878, PRK14878, UGMP family protein; Provisional Back     alignment and domain information
>gnl|CDD|181985 PRK09605, PRK09605, bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>gnl|CDD|37919 KOG2708, KOG2708, KOG2708, Predicted metalloprotease with chaperone activity (RNAse H/HSP70 fold) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185566 PTZ00340, PTZ00340, O-sialoglycoprotein endopeptidase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|30879 COG0533, QRI7, Metal-dependent proteases with possible chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|129429 TIGR00329, gcp_kae1, metallohydrolase, glycoprotease/Kae1 family Back     alignment and domain information
>gnl|CDD|144420 pfam00814, Peptidase_M22, Glycoprotease family Back     alignment and domain information
>gnl|CDD|163437 TIGR03725, bact_YeaZ, universal bacterial protein YeaZ Back     alignment and domain information
>gnl|CDD|31407 COG1214, COG1214, Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30417 COG0068, HypF, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 363 putative DNA-binding/iron metalloprotein/AP endonucleas
PRK09604335 putative DNA-binding/iron metalloprotein/AP endonucleas 100.0
COG0533342 QRI7 Metal-dependent proteases with possible chaperone 100.0
PTZ00340348 O-sialoglycoprotein endopeptidase; Provisional 100.0
PRK09605 536 O-sialoglycoprotein endopeptidase/protein kinase; Revie 100.0
KOG2707405 consensus 100.0
KOG2708336 consensus 100.0
COG2192 555 Predicted carbamoyl transferase, NodU family [Posttrans 99.57
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subuni 98.88
PRK09585366 anmK anhydro-N-acetylmuramic acid kinase; Reviewed 98.75
pfam03702363 UPF0075 Uncharacterized protein family (UPF0075). The p 98.67
PRK03011356 butyrate kinase; Provisional 97.3
PRK13310302 N-acetyl-D-glucosamine kinase; Provisional 97.2
PRK05082291 N-acetylmannosamine kinase; Provisional 97.02
COG1940314 NagC Transcriptional regulator/sugar kinase [Transcript 96.76
TIGR00329337 gcp metalloendopeptidase, putative, glycoprotease famil 100.0
pfam00814225 Peptidase_M22 Glycoprotease family. The Peptidase M22 p 100.0
PRK13317273 pantothenate kinase; Provisional 99.01
TIGR03286404 methan_mark_15 putative methanogenesis marker protein 1 98.82
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-c 98.78
pfam01869288 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family. This fam 98.69
PRK09557301 fructokinase; Reviewed 97.19
TIGR00241259 CoA_E_activ CoA-substrate-specific enzyme activase, put 93.03
COG1214220 Inactive homolog of metal-dependent proteases, putative 99.8
COG0068750 HypF Hydrogenase maturation factor [Posttranslational m 99.42
TIGR00143799 hypF [NiFe] hydrogenase maturation protein HypF; InterP 99.31
pfam03630329 Fumble Fumble. Fumble is required for cell division in 96.95
COG2377371 Predicted molecular chaperone distantly related to HSP7 95.75
TIGR00555387 panK_eukar pantothenate kinase; InterPro: IPR004567 Pan 94.36
pfam02543 360 CmcH_NodU Carbamoyltransferase. This family consists of 98.39
PRK10640471 rhaB rhamnulokinase; Provisional 95.59
PRK09698302 D-allose kinase; Provisional 98.05
PTZ00294510 glycerol kinase; Provisional 96.91
KOG2517516 consensus 95.43
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbohydra 94.61
pfam02782193 FGGY_C FGGY family of carbohydrate kinases, C-terminal 94.48
PRK10331470 L-fuculokinase; Provisional 93.81
COG1069544 AraB Ribulose kinase [Energy production and conversion] 90.75
PRK00047 498 glpK glycerol kinase; Provisional 96.16
PRK04123 542 ribulokinase; Provisional 94.77
pfam00370245 FGGY_N FGGY family of carbohydrate kinases, N-terminal 94.36
PRK10939 521 autoinducer-2 (AI-2) kinase; Provisional 92.19
KOG2201371 consensus 95.24
PRK08674328 bifunctional phosphoglucose/phosphomannose isomerase; V 94.91
PRK00047498 glpK glycerol kinase; Provisional 93.95
COG0554499 GlpK Glycerol kinase [Energy production and conversion] 91.02
PRK08313391 acetyl-CoA acetyltransferase; Provisional 90.57
>PRK09604 putative DNA-binding/iron metalloprotein/AP endonuclease; Reviewed Back     alignment and domain information
>COG0533 QRI7 Metal-dependent proteases with possible chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00340 O-sialoglycoprotein endopeptidase; Provisional Back     alignment and domain information
>PRK09605 O-sialoglycoprotein endopeptidase/protein kinase; Reviewed Back     alignment and domain information
>KOG2707 consensus Back     alignment and domain information
>KOG2708 consensus Back     alignment and domain information
>COG2192 Predicted carbamoyl transferase, NodU family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>PRK09585 anmK anhydro-N-acetylmuramic acid kinase; Reviewed Back     alignment and domain information
>pfam03702 UPF0075 Uncharacterized protein family (UPF0075) Back     alignment and domain information
>PRK03011 butyrate kinase; Provisional Back     alignment and domain information
>PRK13310 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>PRK05082 N-acetylmannosamine kinase; Provisional Back     alignment and domain information
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00329 gcp metalloendopeptidase, putative, glycoprotease family; InterPro: IPR000905 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>pfam00814 Peptidase_M22 Glycoprotease family Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>pfam01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family Back     alignment and domain information
>PRK09557 fructokinase; Reviewed Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative; InterPro: IPR008275 This domain is found in a set of closely related proteins including the (R)-2-hydroxyglutaryl-CoA dehydratase activase of Acidaminococcus fermentans, in longer proteins from Methanococcus jannaschii and Methanobacterium thermoautotrophicum that share an additonal N-terminal domain, in a protein described as a subunit of the benzoyl-CoA reductase of Rhodopseudomonas palustris, and in two repeats of an uncharacterised protein of Aquifex aeolicus Back     alignment and domain information
>COG1214 Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF; InterPro: IPR004421 The large subunit of [NiFe]-hydrogenase, as well as other nickel metalloenzymes, is synthesized as a precursor devoid of the metalloenzyme active site Back     alignment and domain information
>pfam03630 Fumble Fumble Back     alignment and domain information
>COG2377 Predicted molecular chaperone distantly related to HSP70-fold metalloproteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00555 panK_eukar pantothenate kinase; InterPro: IPR004567 Pantothenate kinase (2 Back     alignment and domain information
>pfam02543 CmcH_NodU Carbamoyltransferase Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>PRK09698 D-allose kinase; Provisional Back     alignment and domain information
>PTZ00294 glycerol kinase; Provisional Back     alignment and domain information
>KOG2517 consensus Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>pfam00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>KOG2201 consensus Back     alignment and domain information
>PRK08674 bifunctional phosphoglucose/phosphomannose isomerase; Validated Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>COG0554 GlpK Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target363 putative DNA-binding/iron metalloprotein/AP endonucleas
2ivn_A330 Structure Of Up1 Protein Length = 330 9e-56
3enh_A 540 Crystal Structure Of Cgi121BUD32KAE1 COMPLEX Length 7e-53
2vwb_A 535 Structure Of The Archaeal Kae1-Bud32 Fusion Protein 7e-53
3eno_A334 Crystal Structure Of Pyrococcus Furiosus Pcc1 In Co 5e-52
2gel_A231 2.05a Crystal Structure Of Salmonella Typhimurium Y 1e-06
1okj_A251 Crystal Structure Of The Essential E. Coli Yeaz Pro 2e-06
>gi|157835220|pdb|2IVN|A Chain A, Structure Of Up1 Protein Length = 330 Back     alignment and structure
 Score =  221 bits (564), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 88/344 (25%), Positives = 147/344 (42%), Gaps = 24/344 (6%)

Query: 6   KTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDI 65
              +GIE +     + +V       ++LA    +        GG+ P+ AA  H  ++  
Sbjct: 1   MLALGIEGTAHTLGIGIVSED----KVLANVFDTLTT---EKGGIHPKEAAEHHARLMKP 53

Query: 66  LIKQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHIL 125
           L+++ L  A + + D+D IA + GPGL   L V    A+A++    KP   +NH   H+ 
Sbjct: 54  LLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVE 113

Query: 126 TARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYP 185
             ++        + L VSGG+TQ+L +     Y   G T+D  +G   D  A+ LGL +P
Sbjct: 114 ITKMFGVKDP--VGLYVSGGNTQVLALEG-GRYRVFGETLDIGIGNAIDVFARELGLGFP 170

Query: 186 GGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICA 245
           GG ++EK A  G+          ++            + +           K  + D+  
Sbjct: 171 GGPKVEKLAEKGEKY--------IELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAY 222

Query: 246 SFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFV 305
           SFQ T    L    ++           ++  +V+ GGVA+N+ +R  L  +    G +F 
Sbjct: 223 SFQETAFAALVEVTERAVAHT------EKDEVVLVGGVAANNRLREMLRIMTEDRGIKFF 276

Query: 306 APPARLCTDNAVMIAWAALERMEAGLPADDLSISPRSRWPLDEK 349
            PP  LC DN  MIA+  L   +AG+         + ++  DE 
Sbjct: 277 VPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEV 320


>gi|210061039|pdb|3ENH|A Chain A, Crystal Structure Of Cgi121BUD32KAE1 COMPLEX Length = 540 Back     alignment and structure
gi|197107196|pdb|2VWB|A Chain A, Structure Of The Archaeal Kae1-Bud32 Fusion Protein Mj1130: A Model For The Eukaryotic Ekc-Keops Subcomplex Involved In Transcription And Telomere Homeostasis. Length = 535 Back     alignment and structure
>gi|210061045|pdb|3ENO|A Chain A, Crystal Structure Of Pyrococcus Furiosus Pcc1 In Complex With Thermoplasma Acidophilum Kae1 Length = 334 Back     alignment and structure
gi|112490743|pdb|2GEL|A Chain A, 2.05a Crystal Structure Of Salmonella Typhimurium Yeaz, Form B Length = 231 Back     alignment and structure
>gi|55669531|pdb|1OKJ|A Chain A, Crystal Structure Of The Essential E. Coli Yeaz Protein By Mad Method Using The Gadolinium Complex "dotma" Length = 251 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target363 putative DNA-binding/iron metalloprotein/AP endonucleas
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/protei 1e-78
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops complex, F 6e-63
3eno_A334 Putative O-sialoglycoprotein endopeptidase; hydrolase, 6e-59
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.9 2e-14
2gel_A231 Putative GRAM negative resuscitation promoting factor; 2e-13
2a6a_A218 Hypothetical protein TM0874; glycoprotein endopeptidase 2e-08
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Length = 540 Back     alignment and structure
 Score =  288 bits (738), Expect = 1e-78
 Identities = 103/342 (30%), Positives = 151/342 (44%), Gaps = 27/342 (7%)

Query: 8   VIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILI 67
            +G+E + ++T V +V    S GE+L       I       G+ P  AA  H +    LI
Sbjct: 8   CLGLEGTAEKTGVGIV---TSDGEVLFN---KTIMYKPPKQGINPREAADHHAETFPKLI 61

Query: 68  KQTLLRANMQISDMDSIAVTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTA 127
           K+     +   +++D IA + GPGL   L V    A+ +S    KP   +NH   HI   
Sbjct: 62  KEAFEVVDK--NEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIG 119

Query: 128 RLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGG 187
           +LT +   P L L VSGG+TQ++       Y   G T+D A+G C D+ A+ + LP+PGG
Sbjct: 120 KLTTEAEDP-LTLYVSGGNTQVI-AYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGG 177

Query: 188 VEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICASF 247
             IE+ A  G     K           D +FSGL T+  +   A      + + DIC S 
Sbjct: 178 PYIEELARKG----KKLVDLPYTVKGMDIAFSGLLTAAMRAYDA-----GERLEDICYSL 228

Query: 248 QVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAP 307
           Q     +L    ++      K        +++ GGVA+N+ +R  L  +C      F  P
Sbjct: 229 QEYAFSMLTEITERALAHTNKG------EVMLVGGVAANNRLREMLKAMCEGQNVDFYVP 282

Query: 308 PARLCTDNAVMIAWAALERMEAGL--PADDLSISPRSRWPLD 347
           P   C DN  MIAW  L   + G     D+  I P  R  + 
Sbjct: 283 PKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMV 324


>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Length = 330 Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Length = 334 Back     alignment and structure
>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 2i7p_A* Length = 360 Back     alignment and structure
>2gel_A Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_A Length = 231 Back     alignment and structure
>2a6a_A Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermotoga maritima MSB8} SCOP: c.55.1.9 c.55.1.9 Length = 218 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target363 putative DNA-binding/iron metalloprotein/AP endonucleas
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops complex, F 100.0
3eno_A334 Putative O-sialoglycoprotein endopeptidase; hydrolase, 100.0
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/protei 100.0
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase; act 99.95
2e2o_A299 Hexokinase; acetate and sugar kinases, HSP70, actin sup 98.54
3cqy_A370 Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1313, 98.43
1saz_A381 Probable butyrate kinase 2; askha (acetate and sugar ki 90.09
2gel_A231 Putative GRAM negative resuscitation promoting factor; 99.89
2a6a_A218 Hypothetical protein TM0874; glycoprotein endopeptidase 99.84
2qm1_A326 Glucokinase; alpha-beta structure, putative helix-turn- 98.08
3eo3_A333 Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-ace 97.89
2gup_A292 ROK family protein; sugar kinase, APC80695, sucrose, st 97.35
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, glcnac, 97.01
1zc6_A305 Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo 96.93
2hoe_A380 N-acetylglucosamine kinase; TM1224, structural genomics 96.68
2ap1_A327 Putative regulator protein; zinc binding protein, struc 95.92
3mcp_A366 Glucokinase; structural genomics, joint center for stru 95.76
3epq_A302 Putative fructokinase; SCRK, ADP binding, PSI2, MCSG, s 95.25
3htv_A310 D-allose kinase, allokinase; NP_418508.1, structural ge 95.17
1zbs_A291 Hypothetical protein PG1100; alpha-beta protein., struc 91.75
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.9 99.87
2ews_A287 Pantothenate kinase; PANK, structural genomics, structu 98.59
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, struct 97.96
2aa4_A289 Mannac kinase, putative N-acetylmannosamine kinase; sug 97.75
1z6r_A406 MLC protein; transcriptional repressor, ROK family prot 97.69
1z05_A429 Transcriptional regulator, ROK family; structural genom 97.28
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-bindin 97.15
3l0q_A 554 Xylulose kinase; xlylulose kinase, SGX, PSI, structural 97.33
3h3n_X 506 Glycerol kinase; ATP-binding, glycerol metabolism, nucl 97.23
3g25_A 501 Glycerol kinase; IDP00743, ATP-binding, glycerol metabo 96.28
2dpn_A 495 Glycerol kinase; thermus thermophilus HB8, structural g 94.4
3jvp_A 572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, sugar k 94.22
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonuclease H 97.2
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric regula 96.53
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol metabo 94.15
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structural g 96.87
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xyl 96.23
2w40_A503 Glycerol kinase, putative; closed conformation, malaria 96.06
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phosphory 95.54
3khy_A384 Propionate kinase; csgid, IDP01739, ATP-binding, nucleo 91.98
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J, 90.15
1hjr_A158 Holliday junction resolvase (RUVC); site-specific recom 95.64
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=774.65  Aligned_cols=325  Identities=30%  Similarity=0.452  Sum_probs=300.1

Q ss_pred             CEEEEEECCCHHHEEEEEECCCCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             46887502602207788733888841898873113346212187145599999999699999999998389822453687
Q gi|254781038|r    6 KTVIGIETSCDETAVAVVRRKDSHGEILAEAVLSQIDQHGHYGGVVPEVAARAHVDVLDILIKQTLLRANMQISDMDSIA   85 (363)
Q Consensus         6 ~~ILgIETScd~tsvaiv~~~~~~~~il~~~~~sq~~~~~~~GGv~P~~A~~~H~~~l~~li~~~l~~a~~~~~~id~Ia   85 (363)
                      |+|||||||||+|||||++    +++|++|.+.+|   |.+||||+||+|+|+|.++|+++++++|++++++++|||+||
T Consensus         1 M~iLgIeTScd~tsvAi~~----~~~il~~~~~~~---~~~~GGvvP~~A~r~H~~~l~~~i~~~l~~a~i~~~~id~ia   73 (330)
T 2ivn_A            1 MLALGIEGTAHTLGIGIVS----EDKVLANVFDTL---TTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIA   73 (330)
T ss_dssp             CCEEEEECSSSEEEEEEEC----SSCEEEEEEEEC---CCTTCCCCHHHHHHHHHHHHHHHHHHHHHHHTCCTTTCCEEE
T ss_pred             CEEEEEECCCHHHEEEEEE----CCEEEEEEEEEE---ECCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCEEE
T ss_conf             9099998364402899998----999999988831---267798585899999999999999999998499855686688


Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCCEEEEEECCCEEEEEECCCCCCEECCCCC
Q ss_conf             40664301256779999999887514864333036776530132256799843999706874799983756430002233
Q gi|254781038|r   86 VTAGPGLMGGLIVGLMTAKAISYVSHKPFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTI  165 (363)
Q Consensus        86 vt~gPG~~~~L~vG~~~Ak~la~~~~~Pli~VnH~~aH~~~~~l~~~~~~PfL~LlvSGGhT~l~~~~~~~~~~ilg~T~  165 (363)
                      ||+|||+++||+||+++||+||+++++|+++|||||||++++++...  +||++||||||||++++++. .+|++||+|+
T Consensus        74 vt~gPG~~~~L~vG~~~Ak~la~~~~~P~i~v~Hl~aH~~~~~~~~~--~~pl~llvSGGht~ll~~~~-~~~~ilg~T~  150 (330)
T 2ivn_A           74 FSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGV--KDPVGLYVSGGNTQVLALEG-GRYRVFGETL  150 (330)
T ss_dssp             EEEESSCHHHHHHHHHHHHHHHHHTTCCEEEEEHHHHHHHGGGGGTC--CSCEEEEECSSCEEEEEEET-TEEEEEEEBS
T ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHCCC--CCCEEEEEECCCCEEEEECC-CCEEEEEEEC
T ss_conf             81289841026999999999998608763762639999987653367--76347788268827999837-8538988864


Q ss_pred             CCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCCCHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHH
Q ss_conf             63002388889885288761035566655405733345861110688754221024589999998511201210688999
Q gi|254781038|r  166 DDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSFSGLKTSVQKTICAFDVLEKQDIADICA  245 (363)
Q Consensus       166 Dda~Ge~~DK~ar~Lgl~yPgGp~ie~~A~~g~~~~~~~P~p~~~~~~~dFSFSGLkTav~~~i~~~~~~~~~~~~diaa  245 (363)
                      |||+||+|||+||+|||||||||.||++|++++. .+.+|++.   +++|||||||||+++|.+++.    ++++.|+|+
T Consensus       151 Dda~Gea~DKvar~Lgl~~PgGp~ie~~a~~g~~-~~~~~~~~---~~~~fSFSGlkt~v~~~~~~~----~~~~~diaa  222 (330)
T 2ivn_A          151 DIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEK-YIELPYAV---KGMDLSFSGLLTEAIRKYRSG----KYRVEDLAY  222 (330)
T ss_dssp             SSCHHHHHHHHHHHHTCCSCHHHHHHHHHHTCCS-CCCCCCCE---ETTEECCHHHHHHHHHHHHHT----CSCHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCC-CCCCCCCC---CCCCEECHHHHHHHHHHHHHC----CCCHHHHHH
T ss_conf             7523678999998669988896777899870876-55688788---877230137888889998730----210588889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCEEEECCHHHCCCHHHHHHHHHHH
Q ss_conf             99999999999999999999876214455236541334587999999999998689889962878877258999999999
Q gi|254781038|r  246 SFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCVLHGFRFVAPPARLCTDNAVMIAWAALE  325 (363)
Q Consensus       246 sfQ~~i~~~L~~k~~~a~~~~~~~~~~~~~~lvv~GGVaaN~~LR~~l~~~~~~~~~~~~~P~~~~ctDNAaMIA~ag~~  325 (363)
                      |||++|+++|++|+++|++.+      +++++|++||||||++||++|+++++++|+++++||++|||||||||||+|++
T Consensus       223 sfQ~ai~~~L~~k~~~A~~~~------~~~~lvv~GGVAAN~~LR~~L~~~~~~~g~~~~~Pp~~lCTDNAaMIA~aG~~  296 (330)
T 2ivn_A          223 SFQETAFAALVEVTERAVAHT------EKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLR  296 (330)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH------CCSEEEEESGGGGCHHHHHHHHHHHHHHTCEEECCCHHHHSSCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHH------CCCCEEECCHHHHHHHHHHHHHHHHHHCCCEEECCCHHHCCHHHHHHHHHHHH
T ss_conf             999999999999999999983------99752322157766999999999999759989858868740679999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99849998876200235787875775345
Q gi|254781038|r  326 RMEAGLPADDLSISPRSRWPLDEKAPSKI  354 (363)
Q Consensus       326 ~~~~g~~~~~~~~~~~~rw~ld~~a~~~~  354 (363)
                      +|++|+..+..+..++||||||+...+|-
T Consensus       297 ~~~~G~~~~l~~~~i~prw~Ld~~~v~w~  325 (330)
T 2ivn_A          297 MYKAGISFRLEETIVKQKFRTDEVEIVWH  325 (330)
T ss_dssp             HHHTTCCCCGGGGSCCTTCCGGGSBCTTC
T ss_pred             HHHCCCCCCHHHCCCCCCCCHHCCCCCEE
T ss_conf             99769999877686688895230435000



>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuclease-H fold, sugar kinase, glucose, conformational change; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>3cqy_A Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1313, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis mr-1} Back     alignment and structure
>1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} SCOP: c.55.1.2 c.55.1.2 PDB: 1x9j_A* Back     alignment and structure
>2gel_A Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_A Back     alignment and structure
>2a6a_A Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermotoga maritima MSB8} SCOP: c.55.1.9 c.55.1.9 Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis V583} Back     alignment and structure
>3eo3_A Bifunctional UDP-N-acetylglucosamine 2- epimerase/N-acetylmannosamine kinase; non-protein kinase, sialic acid biosynthesis; 2.84A {Homo sapiens} Back     alignment and structure
>2gup_A ROK family protein; sugar kinase, APC80695, sucrose, structural genomics, PSI, protein structure initiative; HET: SUC; 2.01A {Streptococcus pneumoniae TIGR4} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, ribonuclease H fold, sugar kinase/HSP70/actin superfamily, domain rotation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, structural genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum atcc 12472} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} Back     alignment and structure
>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} Back     alignment and structure
>1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein structure initiative; 2.30A {Porphyromonas gingivalis W83} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 2i7p_A* 3mk6_A* Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, SGC, transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural genomics, transferase, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding protein, helix-turn-helix, phosphotransferase system, metalloprotein; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, PSI, protein structure initiative; 2.00A {Vibrio cholerae o1 biovar eltor str} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, glycerol metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis KOD1} Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleotide-binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, structural genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, structural genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinase-HSP70- actin superfamily, L-rhamnulose kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>3khy_A Propionate kinase; csgid, IDP01739, ATP-binding, nucleotide-binding, transferase, structural genomics; 1.98A {Francisella tularensis subsp} Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 363 putative DNA-binding/iron metalloprotein/AP endonucleas
d2i7na2212 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Hum 6e-28
d1huxa_259 c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component 1e-20
d1okja1106 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherich 2e-16
d2a6aa1103 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermot 1e-13
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 212 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Fumble-like
domain: Pantothenate kinase 1, PANK1
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  118 bits (298), Expect = 6e-28
 Identities = 29/197 (14%), Positives = 58/197 (29%), Gaps = 21/197 (10%)

Query: 135 FPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAA 194
           +P L++ +  G   IL V    +Y R+  T     G  F  +   L        E  + A
Sbjct: 27  YPMLLVNMGSG-VSILAVYSKDNYKRVTGTS--LGGGTFLGLCCLL-TGCETFEEALEMA 82

Query: 195 LMGDGKRFKFPCPLVQGTLCDFSFSGLKTSV----QKTICAFDVLEKQDIADICASFQVT 250
             GD          + G   D+   GL+ S        + + +  +     D+  +  VT
Sbjct: 83  AKGDSTNVDKLVKDIYG--GDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVT 140

Query: 251 VVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHFIRASLIDLCV----LHGFRFVA 306
           +   +      G +    A       +V  G     + +   L+   +        + + 
Sbjct: 141 ITNNI------GSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALF 194

Query: 307 PPAR-LCTDNAVMIAWA 322
                       ++   
Sbjct: 195 LEHEGYFGAVGALLELF 211


>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Length = 259 Back     information, alignment and structure
>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} Length = 103 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target363 putative DNA-binding/iron metalloprotein/AP endonucleas
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [Tax 100.0
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bos tau 92.18
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId: 377 90.72
d1okja1106 Hypothetical protein YeaZ {Escherichia coli [TaxId: 562 99.85
d2a6aa1103 Hypothetical protein TM0874 {Thermotoga maritima [TaxId 99.82
d1hjra_158 RuvC resolvase {Escherichia coli [TaxId: 562]} 94.74
d2hoea3128 N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 93.92
d1z05a3128 Transcriptional regulator VC2007 {Vibrio cholerae [TaxI 92.97
d2ch5a2117 N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) 92.09
d1z6ra2129 Mlc protein {Escherichia coli [TaxId: 562]} 91.65
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli [TaxI 90.85
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acidaminoc 99.69
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus aureu 98.86
d2gupa2175 Hypothetical protein SP2142 {Streptococcus pneumoniae [ 96.06
d1saza2203 butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} 91.88
d2hoea2169 N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 91.55
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 95.19
d2p3ra1252 Glycerol kinase {Escherichia coli [TaxId: 562]} 94.75
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromobacte 94.07
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Fumble-like
domain: Pantothenate kinase 1, PANK1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.5e-34  Score=255.28  Aligned_cols=178  Identities=16%  Similarity=0.129  Sum_probs=152.7

Q ss_pred             CCCCCEEEEEECCCEEEEEECCCCCCEECCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCCCHHCCCC
Q ss_conf             79984399970687479998375643000223363002388889885288761035566655405733345861110688
Q gi|254781038|r  133 IAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGECFDKIAKSLGLPYPGGVEIEKAALMGDGKRFKFPCPLVQGT  212 (363)
Q Consensus       133 ~~~PfL~LlvSGGhT~l~~~~~~~~~~ilg~T~Dda~Ge~~DK~ar~Lgl~yPgGp~ie~~A~~g~~~~~~~P~p~~~~~  212 (363)
                      .+||||.+.++|| |+++.|++..+|++||+|.  +.|++|||++|+| ++||+||+|+++|++|+++.++||++.+.+ 
T Consensus        25 ~pfP~llv~iGsG-tsii~v~~~~~~~~iggT~--~gGgtf~gla~lL-lg~~~~~eI~klA~~G~~~~~dl~~~di~~-   99 (212)
T d2i7na2          25 NPYPMLLVNMGSG-VSILAVYSKDNYKRVTGTS--LGGGTFLGLCCLL-TGCETFEEALEMAAKGDSTNVDKLVKDIYG-   99 (212)
T ss_dssp             SCCSEEEEEESSS-EEEEEEEETTEEEEEEEES--CSHHHHHHHHHHH-HCCCSHHHHHHHHHHCCGGGTSEEHHHHHS-
T ss_pred             CCCCEEEEECCCC-EEEEEEECCCCEEEECCCC--CCHHHHHHHHHHH-CCCCCHHHHHHHHHCCCCCCCCCCCCCCCC-
T ss_conf             9987799997899-5999995598637816875--3088999999996-399998999999966996246762787678-


Q ss_pred             CCCCCCCHHHHHHHHHHHHH----CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHH
Q ss_conf             75422102458999999851----12012106889999999999999999999999987621445523654133458799
Q gi|254781038|r  213 LCDFSFSGLKTSVQKTICAF----DVLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVASNHF  288 (363)
Q Consensus       213 ~~dFSFSGLkTav~~~i~~~----~~~~~~~~~diaasfQ~~i~~~L~~k~~~a~~~~~~~~~~~~~~lvv~GGVaaN~~  288 (363)
                       +|||||||||++++.....    +..++..++|+|+|||++|++.|..++.++...+      ++++++++|||++|+.
T Consensus       100 -~~~s~sgL~t~~~a~~fgk~~~~~~~~~~~~~DiaaS~q~~v~~~l~~~a~~aa~~~------~~k~iv~~Ggv~aN~~  172 (212)
T d2i7na2         100 -GDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNE------NIDRVVFVGNFLRINM  172 (212)
T ss_dssp             -SCBGGGTBCTTSEEETTTTTTSHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHH------TCCCEEEESGGGCSSS
T ss_pred             -CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC------CCCEEEEECCHHHCHH
T ss_conf             -987855678899999731432101343489899999999999999999999999975------9998999772762789


Q ss_pred             HHHHHHHHHHH----CCCEEEECCH-HHCCCHHHHHHHH
Q ss_conf             99999999986----8988996287-8877258999999
Q gi|254781038|r  289 IRASLIDLCVL----HGFRFVAPPA-RLCTDNAVMIAWA  322 (363)
Q Consensus       289 LR~~l~~~~~~----~~~~~~~P~~-~~ctDNAaMIA~a  322 (363)
                      ||+++.+.+.+    .+++++||+- +|+++++|||+++
T Consensus       173 lr~~l~~~~~~~~~~~~i~~~Fp~~~~y~galGA~l~~~  211 (212)
T d2i7na2         173 VSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELF  211 (212)
T ss_dssp             HHHHHHHHHHHHHTTTSCCEEEETTTTCHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHC
T ss_conf             999999999999860791698648745607999999754



>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hjra_ c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6ra2 c.55.1.10 (A:82-210) Mlc protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2gupa2 c.55.1.10 (A:115-289) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1saza2 c.55.1.2 (A:173-375) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 363 putative DNA-binding/iron metalloprotein/AP endonu
2i7n_A_148-346199 (A:148-346) Pantothenate kinase 1; PANK, transfera 5e-31
2ews_A_108-274167 (A:108-274) Pantothenate kinase; PANK, structural 2e-30
2ivn_A_119-282164 (A:119-282) O-sialoglycoprotein endopeptidase; UP1 2e-30
3en9_A_126-286161 (A:126-286) Glycoprotease, O-sialoglycoprotein end 3e-27
3eno_A_127-287161 (A:127-287) Putative O-sialoglycoprotein endopepti 2e-25
1hux_A_96-238143 (A:96-238) Activator of (R)-2-hydroxyglutaryl-COA 3e-16
3en9_A_1-125_287-326165 (A:1-125,A:287-326) Glycoprotease, O-sialoglycopro 6e-27
2ivn_A_1-118_283-330166 (A:1-118,A:283-330) O-sialoglycoprotein endopeptid 6e-25
3eno_A_1-126_288-334173 (A:1-126,A:288-334) Putative O-sialoglycoprotein e 1e-24
2gel_A_1-93_190-231135 (A:1-93,A:190-231) Putative GRAM negative resuscit 9e-21
2a6a_A_1-104_174-218149 (A:1-104,A:174-218) Hypothetical protein TM0874; g 3e-20
3en9_A_1-125_287-326165 (A:1-125,A:287-326) Glycoprotease, O-sialoglycopro 1e-09
2ivn_A_1-118_283-330166 (A:1-118,A:283-330) O-sialoglycoprotein endopeptid 2e-10
3eno_A_1-126_288-334173 (A:1-126,A:288-334) Putative O-sialoglycoprotein e 2e-10
>2i7n_A (A:148-346) Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens}Length = 199 Back     alignment and structure
 Score =  129 bits (325), Expect = 5e-31
 Identities = 26/207 (12%), Positives = 50/207 (24%), Gaps = 26/207 (12%)

Query: 113 PFYAINHLEGHILTARLTDDIAFPYLVLLVSGGHTQILLVRDVAHYDRLGTTIDDALGEC 172
            ++                D  +P  +L+  G    IL V    +Y R+  T        
Sbjct: 6   YYFENPTNPELCQKKPYCLDNPYPM-LLVNMGSGVSILAVYSKDNYKRVTGT-------- 56

Query: 173 FDKIAKSLGLPYPGGVE-----IEKAALMGDGKRFKFPCPLVQGT-LCDFSFSGLKTSVQ 226
                  LGL              + A  GD          + G     F   G   +  
Sbjct: 57  SLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASS 116

Query: 227 KTICAFD-VLEKQDIADICASFQVTVVRILQARLKQGFLLFRKAFPHKQAVLVVSGGVAS 285
                     +     D+  +  VT+   + +  +        A       +V  G    
Sbjct: 117 FGNMMSKEKRDSISKEDLARATLVTITNNIGSIAR------MCALNENIDRVVFVGNFLR 170

Query: 286 NHFIRASLIDLCV----LHGFRFVAPP 308
            + +   L+   +        + +   
Sbjct: 171 INMVSMKLLAYAMDFWSKGQLKALFLE 197


>2ews_A (A:108-274) Pantothenate kinase; PANK, structural genomics, structural genomics consortium, SGC, transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp}Length = 167 Back     alignment and structure
>2ivn_A (A:119-282) O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A*Length = 164 Back     alignment and structure
>3en9_A (A:126-286) Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A*Length = 161 Back     alignment and structure
>3eno_A (A:127-287) Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum}Length = 161 Back     alignment and structure
>1hux_A (A:96-238) Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans}Length = 143 Back     alignment and structure
>3en9_A (A:1-125,A:287-326) Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A*Length = 165 Back     alignment and structure
>2ivn_A (A:1-118,A:283-330) O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A*Length = 166 Back     alignment and structure
>3eno_A (A:1-126,A:288-334) Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum}Length = 173 Back     alignment and structure
>2gel_A (A:1-93,A:190-231) Putative GRAM negative resuscitation promoting factor; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium LT2} PDB: 2gem_A 1okj_ALength = 135 Back     alignment and structure
>2a6a_A (A:1-104,A:174-218) Hypothetical protein TM0874; glycoprotein endopeptidase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermotoga maritima MSB8}Length = 149 Back     alignment and structure
>3en9_A (A:1-125,A:287-326) Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A*Length = 165 Back     alignment and structure
>2ivn_A (A:1-118,A:283-330) O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A*Length = 166 Back     alignment and structure
>3eno_A (A:1-126,A:288-334) Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum}Length = 173 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target363 putative DNA-binding/iron metalloprotein/AP endonucleas
3eno_A_1-126_288-334173 Putative O-sialoglycoprotein endopeptidase; hydrol 100.0
2ivn_A_1-118_283-330166 O-sialoglycoprotein endopeptidase; UP1 keops compl 100.0
3en9_A_1-125_287-326165 Glycoprotease, O-sialoglycoprotein endopeptidase/p 100.0
2gel_A_1-93_190-231135 Putative GRAM negative resuscitation promoting fac 99.85
2a6a_A_1-104_174-218149 Hypothetical protein TM0874; glycoprotein endopept 99.79
1hux_A_1-95_239-270127 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 96.71
1hjr_A_158 Holliday junction resolvase (RUVC); site-specific 96.28
2ch5_A_1-119_314-347153 NAGK protein; transferase, N-acetylglucosamine, gl 96.19
1z05_A_106-216111 Transcriptional regulator, ROK family; structural 94.96
3i8b_A_1-74_255-284_436-494163 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 94.77
2qm1_A_1-131_308-326150 Glucokinase; alpha-beta structure, putative helix- 94.73
2hoe_A_86-211_358-380149 N-acetylglucosamine kinase; TM1224, structural gen 94.17
1z6r_A_83-194112 MLC protein; transcriptional repressor, ROK family 93.48
3eo3_A_1-144_315-333163 Bifunctional UDP-N-acetylglucosamine 2- epimerase/ 92.71
2ews_A_108-274167 Pantothenate kinase; PANK, structural genomics, st 100.0
2ivn_A_119-282164 O-sialoglycoprotein endopeptidase; UP1 keops compl 99.97
3en9_A_126-286161 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.97
2i7n_A_148-346199 Pantothenate kinase 1; PANK, transferase; HET: ACO 99.97
3eno_A_127-287161 Putative O-sialoglycoprotein endopeptidase; hydrol 99.96
1hux_A_96-238143 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 99.79
3gbt_A_238-504267 Gluconate kinase; LBA0354, FGGY kinase family, car 96.53
3cqy_A_146-325180 Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1 96.41
2itm_A_232-484253 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 96.39
3ifr_A_243-508266 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 96.12
3hz6_A_242-511270 Xylulokinase; xylulose, structural genomic, manola 95.65
3jvp_A_279-473195 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 95.53
2dpn_A_242-495