254781039

254781039

putative glycerol-3-phosphate dehydrogenase

GeneID in NCBI database:8210062Locus tag:CLIBASIA_04705
Protein GI in NCBI database:254781039Protein Accession:YP_003065452.1
Gene range:+(1042436, 1043425)Protein Length:329aa
Gene description:putative glycerol-3-phosphate dehydrogenase
COG prediction:[C] Glycerol-3-phosphate dehydrogenase
KEGG prediction:gpsA; putative glycerol-3-phosphate dehydrogenase; K00057 glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
SEED prediction:Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)
Pathway involved in KEGG:Glycerophospholipid metabolism [PATH:las00564]
Subsystem involved in SEED:Glycerolipid and Glycerophospholipid Metabolism in Bacteria;
Glutaredoxins
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MKNYSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLSSYSEKVLPSHSISVLSGPGFARDIAQGLPVGVILSSKNIDISRRLSKILTTDSFRVYCSDDRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSILLNHSSEEQ
ccccccEEEEcccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccHHHcccccccccEEEccHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHcccccEEEEEcccHHHHHHccccEEEEEEcccHHHHHHHHHHHccccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHcccEEEHHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHccccccc
cccccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHcccccccccccccccccEEEcccHHHHHcccEEEEEEcHHHHHHHHHHHHHHcccccEEEEEEccccccHcHHHHHHHHHHcccccEEEEEcccHHHHHHcccccEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccccHHHHHHHHHHccHHHHHHcccEEEccccHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHccccccc
MKNYSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRInakalpgiklspllnfssdhtllqNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKgfeynsgmllssysekvlpshsisvlsgpgfardiaqglpvgvilssknidiSRRLSkilttdsfrvycsddrigvqIGGALKNVIAIASGIlkgrgcgdsARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIAlgrgekqnpdqiQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSILLNHSSEEQ
MKNYSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLSSYSEKVLPSHSISVLSGPGFARDIAQGLPVGvilssknidisrrlskilttdsfrvyCSDDRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSILlnhsseeq
MKNYSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLSSYSEKVLPSHSISVLSGPGFARDIAQGLPVGVILSSKNIDISRRLSKILTTDSFRVYCSDDRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSILLNHSSEEQ
****STI*VIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLSSYSEKVLPSHSISVLSGPGFARDIAQGLPVGVILSSKNIDISRRLSKILTTDSFRVYCSDDRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSI**NH*****
MKNYSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLSSYSEKVLPSHSISVLSGPGFARDIAQGLPVGVILSSKNIDISRRLSKILTTDSFRVYCSDDRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSILLNHSSEEQ
***YSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLSSYSEKVLPSHSISVLSGPGFARDIAQGLPVGVILSSKNIDISRRLSKILTTDSFRVYCSDDRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSILLNH*****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNYSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLSSYSEKVLPSHSISVLSGPGFARDIAQGLPVGVILSSKNIDISRRLSKILTTDSFRVYCSDDRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSILLNHSSEEQ
MKNYSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLSSYSEKVLPSHSISVLSGPGFARDIAQGLPVGVILSSKNIDISRRLSKILTTDSFRVYCSDDRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSILLNHSSEEQ
MKNYSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLSSYSEKVLPSHSISVLSGPGFARDIAQGLPVGVILSSKNIDISRRLSKILTTDSFRVYCSDDRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRLSGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPIFQAISDVMMNHISVDEALSILLNHSSEEQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target329 putative glycerol-3-phosphate dehydrogenase [Candidatus
315122378330 putative glycerol-3-phosphate dehydrogenase [Candidatus 1 1e-137
241206702327 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [R 1 4e-79
116254222327 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [R 1 3e-78
209551269327 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [R 1 7e-78
327188883394 glycerol-3-phosphate dehydrogenase (NAD(P)+) protein [R 1 2e-77
86359483327 glycerol-3-phosphate dehydrogenase (NAD(P)+) protein [R 1 2e-77
222087474329 glycerol-3-phosphate dehydrogenase (NAD(P)+) protein [A 1 2e-77
190893751327 glycerol-3-phosphate dehydrogenase (NAD(P)+) protein [R 1 4e-77
15966830333 glycerol-3-phosphate dehydrogenase protein [Sinorhizobi 1 9e-74
15889906327 glycerol-3-phosphate dehydrogenase [Agrobacterium tumef 1 4e-73
>gi|315122378|ref|YP_004062867.1| putative glycerol-3-phosphate dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 330 Back     alignment and organism information
 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 241/329 (73%), Positives = 290/329 (88%)

Query: 1   MKNYSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLS 60
           MKNY TIFVIG+GAFG+A+SS+IASRG ANVTLLGR+E L+QQL+ TRINAK+LP IKLS
Sbjct: 1   MKNYPTIFVIGSGAFGSAISSIIASRGHANVTLLGRQESLIQQLKSTRINAKSLPNIKLS 60

Query: 61  PLLNFSSDHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEIIICSKGFEYNSGMLLS 120
            LL+FS+D+ LL+ ADIVLFATSSKGY +AL FY  WLK++A+++ICSKGFEY SGMLLS
Sbjct: 61  SLLHFSTDYRLLREADIVLFATSSKGYEQALGFYGQWLKDTADVVICSKGFEYYSGMLLS 120

Query: 121 SYSEKVLPSHSISVLSGPGFARDIAQGLPVGVILSSKNIDISRRLSKILTTDSFRVYCSD 180
            YSEKVLPSHSISVLSGPGFA DIA+GLPVGV L+S+ I+ISRRLS IL+ DSFRVYCSD
Sbjct: 121 DYSEKVLPSHSISVLSGPGFAIDIARGLPVGVTLASEKIEISRRLSAILSGDSFRVYCSD 180

Query: 181 DRIGVQIGGALKNVIAIASGILKGRGCGDSARAIVMVQGLSEIMKLTEAMNGRADTILRL 240
           DRIGVQ+GGALKN+IAIASGILKGR  GDSARA++MV+GLSEI+++T+AM GR+DTIL L
Sbjct: 181 DRIGVQLGGALKNIIAIASGILKGREYGDSARAMMMVRGLSEIIEVTKAMGGRSDTILGL 240

Query: 241 SGVGDLILTATSEQSRNFCFGIALGRGEKQNPDQIQLVEGAIAVSCVINISKKMGLKLPI 300
           SG+GDL+LTATSEQSRNFCFG+ LG+G++ +   + LVEG IAVS VINI+ KMGL LP+
Sbjct: 241 SGIGDLVLTATSEQSRNFCFGVFLGKGQQYDFKTMNLVEGGIAVSRVINIAIKMGLDLPV 300

Query: 301 FQAISDVMMNHISVDEALSILLNHSSEEQ 329
           FQA SDV+ N I+VDEAL I L+ SS+++
Sbjct: 301 FQATSDVIANRITVDEALDIFLDLSSKKK 329


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241206702|ref|YP_002977798.1| NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 327 Back     alignment and organism information
>gi|116254222|ref|YP_770060.1| NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [Rhizobium leguminosarum bv. viciae 3841] Length = 327 Back     alignment and organism information
>gi|209551269|ref|YP_002283186.1| NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 327 Back     alignment and organism information
>gi|327188883|gb|EGE56075.1| glycerol-3-phosphate dehydrogenase (NAD(P)+) protein [Rhizobium etli CNPAF512] Length = 394 Back     alignment and organism information
>gi|86359483|ref|YP_471375.1| glycerol-3-phosphate dehydrogenase (NAD(P)+) protein [Rhizobium etli CFN 42] Length = 327 Back     alignment and organism information
>gi|222087474|ref|YP_002546011.1| glycerol-3-phosphate dehydrogenase (NAD(P)+) protein [Agrobacterium radiobacter K84] Length = 329 Back     alignment and organism information
>gi|190893751|ref|YP_001980293.1| glycerol-3-phosphate dehydrogenase (NAD(P)+) protein [Rhizobium etli CIAT 652] Length = 327 Back     alignment and organism information
>gi|15966830|ref|NP_387183.1| glycerol-3-phosphate dehydrogenase protein [Sinorhizobium meliloti 1021] Length = 333 Back     alignment and organism information
>gi|15889906|ref|NP_355587.1| glycerol-3-phosphate dehydrogenase [Agrobacterium tumefaciens str. C58] Length = 327 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target329 putative glycerol-3-phosphate dehydrogenase [Candidatus
PRK00094325 PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate 2e-91
PRK12439341 PRK12439, PRK12439, NAD(P)H-dependent glycerol-3-phosph 1e-52
PRK14620326 PRK14620, PRK14620, NAD(P)H-dependent glycerol-3-phosph 4e-52
PRK14618328 PRK14618, PRK14618, NAD(P)H-dependent glycerol-3-phosph 1e-50
PRK14619308 PRK14619, PRK14619, NAD(P)H-dependent glycerol-3-phosph 2e-41
TIGR03376342 TIGR03376, glycerol3P_DH, glycerol-3-phosphate dehydrog 2e-39
KOG2711372 KOG2711, KOG2711, KOG2711, Glycerol-3-phosphate dehydro 7e-38
COG0240329 COG0240, GpsA, Glycerol-3-phosphate dehydrogenase [Ener 1e-82
pfam07479145 pfam07479, NAD_Gly3P_dh_C, NAD-dependent glycerol-3-pho 1e-30
pfam01210159 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol-3-pho 8e-30
COG1893307 COG1893, ApbA, Ketopantoate reductase [Coenzyme metabol 0.001
PTZ00345365 PTZ00345, PTZ00345, glycerol-3-phosphate dehydrogenase; 4e-17
cd05213311 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding do 3e-04
PRK08229341 PRK08229, PRK08229, 2-dehydropantoate 2-reductase; Prov 3e-04
COG0373414 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabo 5e-04
>gnl|CDD|178859 PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|171500 PRK12439, PRK12439, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173083 PRK14620, PRK14620, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184769 PRK14618, PRK14618, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184770 PRK14619, PRK14619, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|163240 TIGR03376, glycerol3P_DH, glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>gnl|CDD|37922 KOG2711, KOG2711, KOG2711, Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30589 COG0240, GpsA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|116100 pfam07479, NAD_Gly3P_dh_C, NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus Back     alignment and domain information
>gnl|CDD|110228 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>gnl|CDD|32077 COG1893, ApbA, Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|185569 PTZ00345, PTZ00345, glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>gnl|CDD|181308 PRK08229, PRK08229, 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>gnl|CDD|30722 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 329 putative glycerol-3-phosphate dehydrogenase [Candidatus
PRK12439340 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; P 100.0
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 100.0
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 100.0
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+ 100.0
KOG2711372 consensus 100.0
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 99.92
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.85
PRK12921306 2-dehydropantoate 2-reductase; Provisional 99.77
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.77
PRK05708305 2-dehydropantoate 2-reductase; Provisional 99.76
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 99.76
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 99.75
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.7
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 99.69
PRK11559295 garR tartronate semialdehyde reductase; Provisional 99.66
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.6
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 99.46
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 99.13
KOG0409327 consensus 99.01
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 99.01
TIGR00872341 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylati 98.36
PRK13403335 ketol-acid reductoisomerase; Provisional 98.1
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase; Int 97.18
COG4408431 Uncharacterized protein conserved in bacteria [Function 97.18
pfam10100429 DUF2338 Uncharacterized protein conserved in bacteria ( 96.75
TIGR02437716 FadB fatty oxidation complex, alpha subunit FadB; Inter 93.51
pfam07479145 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehyd 100.0
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 100.0
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 99.52
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 99.35
PRK07417280 arogenate dehydrogenase; Reviewed 99.35
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 99.32
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.29
COG2085211 Predicted dinucleotide-binding enzymes [General functio 99.27
PRK08655 441 prephenate dehydrogenase; Provisional 99.27
PRK08507275 prephenate dehydrogenase; Validated 99.23
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.09
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.03
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.96
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 98.87
PRK06545357 prephenate dehydrogenase; Validated 98.87
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 98.86
PTZ00142 474 6-phosphogluconate dehydrogenase; Provisional 98.83
TIGR01915233 npdG NADPH-dependent F420 reductase; InterPro: IPR01018 98.46
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 98.4
TIGR02279 508 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC; I 98.3
TIGR00873 480 gnd 6-phosphogluconate dehydrogenase, decarboxylating; 98.12
pfam02153258 PDH Prephenate dehydrogenase. Members of this family ar 98.01
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 97.89
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate tran 97.89
KOG3124267 consensus 97.76
PRK00048265 dihydrodipicolinate reductase; Provisional 97.61
PRK08818373 prephenate dehydrogenase; Provisional 97.49
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.49
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 97.44
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 97.35
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 97.31
TIGR00112274 proC pyrroline-5-carboxylate reductase; InterPro: IPR00 97.27
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohy 97.26
PRK13984604 putative oxidoreductase; Provisional 97.1
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolase 96.98
COG4007340 Predicted dehydrogenase related to H2-forming N5,N10-me 96.97
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 96.91
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 96.85
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 96.74
KOG2653 487 consensus 96.62
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 96.6
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- 96.48
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 96.46
PRK06444197 prephenate dehydrogenase; Provisional 95.91
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 95.77
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, 95.75
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 95.54
PRK05562222 precorrin-2 dehydrogenase; Provisional 95.48
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 93.93
PRK06370459 mercuric reductase; Validated 93.91
PRK06719157 precorrin-2 dehydrogenase; Validated 93.6
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.37
PRK06116450 glutathione reductase; Validated 92.91
TIGR01921326 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR0101 92.2
TIGR01415426 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme 92.02
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 91.72
PRK13748561 putative mercuric reductase; Provisional 91.46
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 90.38
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 90.25
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.63
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.59
PRK07680273 late competence protein ComER; Validated 99.55
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.53
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 99.52
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 99.48
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 99.4
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 99.1
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.0
KOG2666 481 consensus 98.12
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid transport 98.04
TIGR01692290 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IP 97.89
PRK05479336 ketol-acid reductoisomerase; Provisional 97.85
KOG2380480 consensus 97.47
PRK05225 489 ketol-acid reductoisomerase; Validated 97.38
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB; InterPro: 93.37
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 99.43
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 99.41
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.12
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.07
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.05
PRK07660283 consensus 98.99
PRK09117282 consensus 98.97
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 98.97
PRK08268 503 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.87
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 98.86
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.78
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 98.46
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 98.46
PTZ00117313 malate dehydrogenase; Provisional 98.42
PTZ00082322 L-lactate dehydrogenase; Provisional 98.41
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] 98.4
PRK11154706 fadJ multifunctional fatty acid oxidation complex subun 98.28
KOG2304298 consensus 98.25
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 98.2
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 98.19
PRK06223312 malate dehydrogenase; Reviewed 98.19
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 98.1
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 98.01
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 98.01
PTZ00325313 malate dehydrogenase; Provisional 97.92
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 97.92
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 97.92
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 97.88
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 97.81
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 97.71
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.69
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 97.68
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 97.65
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 97.59
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 97.56
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 97.55
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 97.53
PRK06436303 glycerate dehydrogenase; Provisional 97.48
PRK05086312 malate dehydrogenase; Provisional 97.44
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 97.41
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.4
pfam07991165 IlvN Acetohydroxy acid isomeroreductase, catalytic doma 97.38
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 97.38
PRK12557341 H(2)-dependent methylenetetrahydromethanopterin dehydro 97.37
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 97.33
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 97.33
PRK13243333 glyoxylate reductase; Reviewed 97.32
PRK12480330 D-lactate dehydrogenase; Provisional 97.28
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 97.28
PRK06487317 glycerate dehydrogenase; Provisional 97.28
PRK06823315 ornithine cyclodeaminase; Validated 97.27
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 97.25
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 97.2
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 97.19
PRK05442325 malate dehydrogenase; Provisional 97.19
pfam00899134 ThiF ThiF family. This family contains a repeated domai 97.17
PRK13303265 L-aspartate dehydrogenase; Provisional 97.16
PRK07589346 ornithine cyclodeaminase; Validated 97.16
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 97.15
PRK07340304 ornithine cyclodeaminase; Validated 97.14
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 97.14
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 97.14
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 97.13
TIGR01771302 L-LDH-NAD L-lactate dehydrogenase; InterPro: IPR011304 97.1
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 97.09
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 97.08
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 97.03
PRK07574385 formate dehydrogenase; Provisional 97.03
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 97.02
KOG0069336 consensus 97.02
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 96.98
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 96.98
PRK08291330 ornithine cyclodeaminase; Validated 96.95
PRK06407302 ornithine cyclodeaminase; Provisional 96.92
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 96.91
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 96.9
pfam02423312 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin 96.87
PRK08269311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.87
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 96.86
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 96.86
PRK08328230 hypothetical protein; Provisional 96.8
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 96.78
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 96.75
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 96.67
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 96.66
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.66
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin homol 96.65
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 96.63
KOG2305313 consensus 96.59
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 96.48
PRK07411390 hypothetical protein; Validated 96.47
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Validated 96.47
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 96.42
PRK05600370 thiamine biosynthesis protein ThiF; Validated 96.42
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 96.41
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 96.29
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 96.28
KOG1495332 consensus 96.21
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 96.14
PRK03659602 glutathione-regulated potassium-efflux system protein K 96.04
PRK03562615 glutathione-regulated potassium-efflux system protein K 95.88
PRK06349 432 homoserine dehydrogenase; Provisional 95.56
PRK11579346 putative oxidoreductase; Provisional 95.44
cd01486307 Apg7 Apg7 is an E1-like protein, that activates two dif 95.41
PRK08040337 putative semialdehyde dehydrogenase; Provisional 95.35
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 95.3
TIGR02441740 fa_ox_alpha_mit fatty acid oxidation complex, alpha sub 95.27
PRK08223287 hypothetical protein; Validated 95.21
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 94.98
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 94.84
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 94.68
PRK08300298 acetaldehyde dehydrogenase; Validated 94.28
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 94.19
PRK06270342 homoserine dehydrogenase; Provisional 93.95
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 93.55
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 93.53
pfam03447116 NAD_binding_3 Homoserine dehydrogenase, NAD binding dom 93.45
KOG2741351 consensus 93.33
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF; InterPro: 93.16
cd04510334 consensus 93.14
PRK10206345 putative dehydrogenase; Provisional 92.96
PRK07097265 gluconate 5-dehydrogenase; Provisional 92.62
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 92.43
PRK00811283 spermidine synthase; Provisional 92.29
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 92.16
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 91.87
PRK08306296 dipicolinate synthase subunit A; Reviewed 91.26
TIGR02440732 FadJ fatty oxidation complex, alpha subunit FadJ; Inter 91.18
PRK07825273 short chain dehydrogenase; Provisional 90.99
PRK06153393 hypothetical protein; Provisional 90.86
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). 90.07
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 98.11
PRK09496 455 trkA potassium transporter peripheral membrane componen 98.08
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.03
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 97.95
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 97.93
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 97.73
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.6
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.52
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 97.52
PRK13940414 glutamyl-tRNA reductase; Provisional 97.49
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 97.38
PRK06141313 ornithine cyclodeaminase; Validated 96.94
PRK08618325 ornithine cyclodeaminase; Validated 96.93
PRK06046326 alanine dehydrogenase; Validated 96.92
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 96.86
COG2344211 AT-rich DNA-binding protein [General function predictio 96.67
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 96.61
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; P 96.59
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 96.55
PRK06199379 ornithine cyclodeaminase; Validated 96.46
CHL00194319 ycf39 Ycf39; Provisional 96.38
pfam02056183 Glyco_hydro_4 Family 4 glycosyl hydrolase. 96.15
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 4. G 96.02
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 95.9
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 95.68
COG2910211 Putative NADH-flavin reductase [General function predic 95.23
pfam0262996 CoA_binding CoA binding domain. This domain has a Rossm 95.08
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3. 94.59
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 94.29
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 94.24
KOG1502327 consensus 93.22
KOG03992142 consensus 92.69
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat 92.68
TIGR02371327 ala_DH_arch alanine dehydrogenase; InterPro: IPR012742 92.52
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 92.52
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 92.37
PRK03612516 spermidine synthase; Provisional 90.76
TIGR02992326 ectoine_eutC ectoine utilization protein EutC; InterPro 90.02
PRK00421 459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 97.42
PRK06847375 hypothetical protein; Provisional 97.35
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 97.04
PRK09496455 trkA potassium transporter peripheral membrane componen 97.01
PRK12831464 putative oxidoreductase; Provisional 96.97
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.75
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 96.7
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 96.68
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 96.65
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 96.59
PRK11749460 putative oxidoreductase; Provisional 96.52
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.46
PRK07236386 hypothetical protein; Provisional 96.26
PRK08163396 salicylate hydroxylase; Provisional 96.15
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 96.07
PRK10669558 putative cation:proton antiport protein; Provisional 95.98
PRK06101241 short chain dehydrogenase; Provisional 95.96
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.87
PRK07102243 short chain dehydrogenase; Provisional 95.82
PRK07208 474 hypothetical protein; Provisional 95.67
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.65
PRK05868372 hypothetical protein; Validated 95.63
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.62
PRK07454241 short chain dehydrogenase; Provisional 95.57
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 95.55
PRK06180277 short chain dehydrogenase; Provisional 95.55
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 95.45
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.43
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 95.41
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 95.4
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.32
PRK06753373 hypothetical protein; Provisional 95.32
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 95.3
PRK11259377 solA N-methyltryptophan oxidase; Provisional 95.29
PRK08643256 acetoin reductase; Validated 95.28
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 95.17
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 95.16
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.14
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.13
PRK07045388 putative monooxygenase; Reviewed 95.1
PRK08017256 short chain dehydrogenase; Provisional 95.09
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.04
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.04
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.0
PRK13512 438 coenzyme A disulfide reductase; Provisional 94.92
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 94.92
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 94.87
PRK07588391 hypothetical protein; Provisional 94.84
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 94.75
PRK07024256 short chain dehydrogenase; Provisional 94.62
PRK07707239 consensus 94.6
PRK01368 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.55
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 94.55
PRK11861673 bifunctional prephenate dehydrogenase/3-phosphoshikimat 94.5
pfam00743 532 FMO-like Flavin-binding monooxygenase-like. This family 94.33
PRK12746254 short chain dehydrogenase; Provisional 94.31
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 94.29
PRK07326235 short chain dehydrogenase; Provisional 94.23
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of amino a 94.2
PRK11728400 hypothetical protein; Provisional 94.19
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.13
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 94.13
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 94.08
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 94.05
PRK08013400 hypothetical protein; Provisional 94.02
PRK08251248 short chain dehydrogenase; Provisional 93.94
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 93.93
PRK06500249 short chain dehydrogenase; Provisional 93.83
PRK08774402 consensus 93.74
PRK07062265 short chain dehydrogenase; Provisional 93.69
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 93.68
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 93.64
PRK08339263 short chain dehydrogenase; Provisional 93.55
PRK06182273 short chain dehydrogenase; Validated 93.5
PRK08340259 glucose-1-dehydrogenase; Provisional 93.46
PRK12743253 acetoin dehydrogenase; Provisional 93.43
PRK05717255 oxidoreductase; Validated 93.4
PRK06475400 salicylate hydroxylase; Provisional 93.39
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 93.34
PRK06126 545 hypothetical protein; Provisional 93.34
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.34
PRK05993277 short chain dehydrogenase; Provisional 93.31
KOG1298 509 consensus 93.28
PRK06185409 hypothetical protein; Provisional 93.25
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.2
PRK07538413 hypothetical protein; Provisional 93.14
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 93.05
KOG1399 448 consensus 93.04
PRK08277278 D-mannonate oxidoreductase; Provisional 93.04
PRK09072262 short chain dehydrogenase; Provisional 93.01
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 92.95
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 92.95
PRK05876275 short chain dehydrogenase; Provisional 92.94
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 92.91
PRK08945245 short chain dehydrogenase; Provisional 92.89
PRK06483236 short chain dehydrogenase; Provisional 92.89
PRK07074256 short chain dehydrogenase; Provisional 92.88
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 92.85
PRK07041240 short chain dehydrogenase; Provisional 92.84
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 92.83
PRK08703239 short chain dehydrogenase; Provisional 92.82
PRK08267258 short chain dehydrogenase; Provisional 92.81
PRK07479252 consensus 92.78
PRK05249 465 soluble pyridine nucleotide transhydrogenase; Provision 92.76
PRK06194301 hypothetical protein; Provisional 92.74
COG1233 487 Phytoene dehydrogenase and related proteins [Secondary 92.72
PRK06179270 short chain dehydrogenase; Provisional 92.68
PRK09126392 hypothetical protein; Provisional 92.64
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 92.58
PRK06482276 short chain dehydrogenase; Provisional 92.54
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 92.53
PRK12824245 acetoacetyl-CoA reductase; Provisional 92.51
PRK07775275 short chain dehydrogenase; Provisional 92.46
PRK07233 430 hypothetical protein; Provisional 92.45
PRK08085254 gluconate 5-dehydrogenase; Provisional 92.43
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 92.39
PRK07677254 short chain dehydrogenase; Provisional 92.39
PRK05872296 short chain dehydrogenase; Provisional 92.33
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 92.15
PRK05693274 short chain dehydrogenase; Provisional 92.12
PRK07478254 short chain dehydrogenase; Provisional 92.08
PRK06914280 short chain dehydrogenase; Provisional 92.01
PRK06953222 short chain dehydrogenase; Provisional 92.0
PRK08263275 short chain dehydrogenase; Provisional 91.96
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.95
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 91.91
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.91
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.78
TIGR02734 526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 91.76
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 91.72
PRK09135249 pteridine reductase; Provisional 91.68
PRK06346251 consensus 91.67
PRK08862227 short chain dehydrogenase; Provisional 91.62
PRK07776252 consensus 91.56
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 91.56
KOG0685 498 consensus 91.56
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 91.53
PRK06947252 glucose-1-dehydrogenase; Provisional 91.51
PRK09291257 short chain dehydrogenase; Provisional 91.51
PRK09134256 short chain dehydrogenase; Provisional 91.43
PRK06181263 short chain dehydrogenase; Provisional 91.43
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 91.41
PRK06123249 short chain dehydrogenase; Provisional 91.38
PRK06184 503 hypothetical protein; Provisional 91.37
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 91.31
PRK05650270 short chain dehydrogenase; Provisional 91.31
PRK07608389 hypothetical protein; Provisional 91.3
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 91.28
PRK07814263 short chain dehydrogenase; Provisional 91.22
PRK07774250 short chain dehydrogenase; Provisional 91.21
PRK12828239 short chain dehydrogenase; Provisional 91.17
PRK07190 480 hypothetical protein; Provisional 91.1
PRK06949258 short chain dehydrogenase; Provisional 91.06
PRK12770350 putative glutamate synthase subunit beta; Provisional 91.04
PRK12939250 short chain dehydrogenase; Provisional 91.01
KOG0029 501 consensus 91.0
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 90.96
PRK13234293 nifH nitrogenase reductase; Reviewed 90.92
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 90.89
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.71
PRK12937245 short chain dehydrogenase; Provisional 90.62
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 90.57
PRK06124259 gluconate 5-dehydrogenase; Provisional 90.57
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 90.4
PRK06940277 short chain dehydrogenase; Provisional 90.39
PRK06834 488 hypothetical protein; Provisional 90.38
PRK11101 545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 90.37
PRK04965378 nitric oxide reductase; Provisional 90.34
PRK07063259 short chain dehydrogenase; Provisional 90.28
PRK05866290 short chain dehydrogenase; Provisional 90.28
PRK05884223 short chain dehydrogenase; Provisional 90.26
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 90.25
COG0579429 Predicted dehydrogenase [General function prediction on 90.23
PRK07035252 short chain dehydrogenase; Provisional 90.23
COG3349 485 Uncharacterized conserved protein [Function unknown] 90.21
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.21
PRK11883 452 protoporphyrinogen oxidase; Reviewed 90.19
PRK08213259 gluconate 5-dehydrogenase; Provisional 90.17
PRK08265261 short chain dehydrogenase; Provisional 90.05
PRK12829264 short chain dehydrogenase; Provisional 90.03
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 97.38
PRK06932314 glycerate dehydrogenase; Provisional 97.02
PRK12550272 shikimate 5-dehydrogenase; Reviewed 94.41
PTZ00052 541 thioredoxin reductase; Provisional 91.28
PRK09564443 coenzyme A disulfide reductase; Reviewed 90.52
PRK08324676 short chain dehydrogenase; Validated 90.49
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 90.48
PRK08605332 D-lactate dehydrogenase; Validated 96.78
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 96.41
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.25
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.49
PRK13771332 putative alcohol dehydrogenase; Provisional 92.92
PRK09880343 L-idonate 5-dehydrogenase; Provisional 92.15
pfam08546125 ApbA_C Ketopantoate reductase PanE/ApbA C terminal. Thi 91.61
TIGR01724341 hmd_rel coenzyme F420-dependent N(5),N(10)-methenyltetr 90.26
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>KOG2711 consensus Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR003710 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>KOG0409 consensus Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating); InterPro: IPR004849 This family resembles a larger family of bacterial and eukaryotic 6-phosphogluconate dehydrogenases (Gnd) but differs from it by a deep split in a UPGMA similarity clustering tree and the lack of a central region of about 140 residues Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase; InterPro: IPR006398 These sequences represent 2-hydroxy-3-oxopropionate reductase (1 Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam10100 DUF2338 Uncharacterized protein conserved in bacteria (DUF2338) Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB; InterPro: IPR012799 Members of this family represent the alpha subunit of the multifunctional enzyme complex of the fatty acid degradation cycle Back     alignment and domain information
>pfam07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus Back     alignment and domain information
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase; InterPro: IPR010185 Members of this family are found only in species with evidence of coenzyme F420 Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC; InterPro: IPR011967 This 3-hydroxyacyl-CoA dehydrogenase is involved in the degradation of phenylacetic acid, presumably in steps following the opening of the phenyl ring Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating; InterPro: IPR006113 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>pfam02153 PDH Prephenate dehydrogenase Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3124 consensus Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase; InterPro: IPR000304 Delta 1-pyrroline-5-carboxylate reductase (P5CR) (1 Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG2653 consensus Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase, small subunit; InterPro: IPR006006 One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1 Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric; InterPro: IPR006004 One pathway for the assimilation of ammonia and glutamate biosynthesis involves homotetrameric glutamate synthase (1 Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR010190 This entry represents the diaminopimelate dehydrogenase enzyme which provides an alternate (shortcut) route of lysine biosynthesis in Corynebacterium, Bacterioides, Porphyromonas and other species Back     alignment and domain information