254781045

254781045

outer membrane lipoprotein omp19

GeneID in NCBI database:8210068Locus tag:CLIBASIA_04735
Protein GI in NCBI database:254781045Protein Accession:YP_003065458.1
Gene range:+(1047564, 1048052)Protein Length:162aa
Gene description:outer membrane lipoprotein omp19
COG prediction:none
KEGG prediction:outer membrane lipoprotein omp19
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MHFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEEEFDQDDISVPSKDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIISR
ccHHHHHHHHHHHHHHHccccccccccccccccccEEcccccccccccccccHHHccHHccccccccccccccEEEEEEEEEccccEEEEEEEcccccccccccccHHHHHHHHHHccccccccEEEEEcccccEEEEEEEccccEEEEEEcccccEEEEEc
ccHHHHHHHHHHHHHHHHccccEEEcccccccccccccccccccccccccccHHHccccccccccccccHHHHccEcEEEEEcccccccEEEEEEcccccccccccccHHHHHHHHHHHHccccEEEEEcccccEEEEEEEccccccccccccccccEEEEc
MHFYRFILLNLYMLTLFshgctqidfgniffkkpeislppsveseillppipeeefdqddisvpskdnnaiRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAawniidedsfelknkSGQTIIVFYKTAeqsfegsfqgesdkviisr
MHFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEEEFDQDDIsvpskdnnaiRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTaeqsfegsfqgesdkviisr
MHFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESeillppipeeeFDQDDISVPSKDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIISR
****RFI*LNLYMLTLFSHGCTQI***********************************************RMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGES*KVIIS*
MHFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEEEFDQDDISVPSKDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSF***************
*HFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEEEFDQDDISVPSKDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSF*******SD******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MHFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEEEFDQDDISVPSKDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIISR
MHFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEEEFDQDDISVPSKDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIISR
MHFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEEEFDQDDISVPSKDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNIIDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIISR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target162 outer membrane lipoprotein omp19 [Candidatus Liberibact
315122384161 outer membrane lipoprotein omp19 [Candidatus Liberibact 1 4e-50
163761411191 putative outer membrane lipoprotein precursor [Hoeflea 1 1e-09
325294010180 hypothetical protein AGROH133_08857 [Agrobacterium sp. 1 5e-09
15889897180 hypothetical protein Atu2641 [Agrobacterium tumefaciens 1 1e-08
150398143179 outer membrane lipoprotein omp19 [Sinorhizobium medicae 1 5e-08
304394270205 putative Outer membrane lipoprotein Omp19-like protein 1 6e-08
114705846180 putative outer membrane lipoprotein precursor [Fulvimar 1 9e-08
227823647179 putative outer membrane lipoprotein Omp19 [Sinorhizobiu 1 1e-07
327188898188 outer membrane lipoprotein [Rhizobium etli CNPAF512] Le 1 2e-07
190893741171 outer membrane lipoprotein [Rhizobium etli CIAT 652] Le 1 3e-07
>gi|315122384|ref|YP_004062873.1| outer membrane lipoprotein omp19 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 161 Back     alignment and organism information
 Score =  201 bits (510), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 97/162 (59%), Positives = 121/162 (74%), Gaps = 1/162 (0%)

Query: 1   MHFYRFILLNLYMLTLFSHGCTQIDFGNIFFKKPEISLPPSVESEILLPPIPEEEFDQDD 60
           M  YRF  +  YML L S+GC   DF + F KK +  +P S+ESE L PP+ EEE DQD+
Sbjct: 1   MRSYRFAFMVFYMLALSSYGCVAPDFKSFFSKKTQ-PVPSSIESEDLAPPVSEEELDQDN 59

Query: 61  ISVPSKDNNAIRMGIIGAWKVSYRDVDCKMILTLTRFKKNFRGTARSCHGRLASLAAWNI 120
           IS P KDN AIRM IIG+WK S++ + C + LTLTR KK+FRGTAR C+G+LA L++WNI
Sbjct: 60  ISSPVKDNAAIRMEIIGSWKTSHQGIACNLTLTLTRLKKDFRGTARGCYGKLALLSSWNI 119

Query: 121 IDEDSFELKNKSGQTIIVFYKTAEQSFEGSFQGESDKVIISR 162
           ++++SFELKNK G+TIIVF KT EQSFEGSF GES+ V I R
Sbjct: 120 VNKNSFELKNKVGKTIIVFRKTGEQSFEGSFDGESEIVSIYR 161


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163761411|ref|ZP_02168485.1| putative outer membrane lipoprotein precursor [Hoeflea phototrophica DFL-43] Length = 191 Back     alignment and organism information
>gi|325294010|ref|YP_004279874.1| hypothetical protein AGROH133_08857 [Agrobacterium sp. H13-3] Length = 180 Back     alignment and organism information
>gi|15889897|ref|NP_355578.1| hypothetical protein Atu2641 [Agrobacterium tumefaciens str. C58] Length = 180 Back     alignment and organism information
>gi|150398143|ref|YP_001328610.1| outer membrane lipoprotein omp19 [Sinorhizobium medicae WSM419] Length = 179 Back     alignment and organism information
>gi|304394270|ref|ZP_07376193.1| putative Outer membrane lipoprotein Omp19-like protein [Ahrensia sp. R2A130] Length = 205 Back     alignment and organism information
>gi|114705846|ref|ZP_01438749.1| putative outer membrane lipoprotein precursor [Fulvimarina pelagi HTCC2506] Length = 180 Back     alignment and organism information
>gi|227823647|ref|YP_002827620.1| putative outer membrane lipoprotein Omp19 [Sinorhizobium fredii NGR234] Length = 179 Back     alignment and organism information
>gi|327188898|gb|EGE56090.1| outer membrane lipoprotein [Rhizobium etli CNPAF512] Length = 188 Back     alignment and organism information
>gi|190893741|ref|YP_001980283.1| outer membrane lipoprotein [Rhizobium etli CIAT 652] Length = 171 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target162 outer membrane lipoprotein omp19 [Candidatus Liberibact
pfam0297498 pfam02974, Inh, Protease inhibitor Inh 1e-06
>gnl|CDD|145888 pfam02974, Inh, Protease inhibitor Inh Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 162 outer membrane lipoprotein omp19 [Candidatus Liberibact
pfam06604181 consensus 100.0
pfam0297498 Inh Protease inhibitor Inh. The Inh inhibitor is secret 99.87
>pfam06604 consensus Back     alignment and domain information
>pfam02974 Inh Protease inhibitor Inh Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target162 outer membrane lipoprotein omp19 [Candidatus Liberibact
1jiw_I106 Proteinase inhibitor; pseudomonas aeruginosa alkaline p 99.58
1smp_I101 Erwinia chrysanthemi inhibitor; complex (metalloproteas 98.43
>1jiw_I Proteinase inhibitor; pseudomonas aeruginosa alkaline protease inhibitor, hydrolase/hyrolase inhibitor complex; 1.74A {Pseudomonas aeruginosa} SCOP: b.61.2.1 PDB: 2rn4_A Back     alignment and structure
Probab=99.58  E-value=2.8e-15  Score=112.57  Aligned_cols=90  Identities=14%  Similarity=0.362  Sum_probs=78.4

Q ss_pred             CCHHEEEEEEECCCCC--EEEEEEECCCCC--CCCCCCCC-CCCCCH--HCCCCEEECCCCEEEEECCCCCEEEEEEECC
Q ss_conf             7011365788636897--368897136677--77145436-773000--0021003338718999828998799999548
Q gi|254781045|r   71 IRMGIIGAWKVSYRDV--DCKMILTLTRFK--KNFRGTAR-SCHGRL--ASLAAWNIIDEDSFELKNKSGQTIIVFYKTA  143 (162)
Q Consensus        71 ~r~sl~G~W~vs~~g~--sC~v~Lt~t~~~--~Gyra~~~-gC~g~L--~~i~aW~v~G~~vl~L~D~sG~~v~~l~~s~  143 (162)
                      +.++|+|.|+++.+++  .|+|+|+.++..  +||+.... +|...+  +.+.+|.+.+++ ++|+|+.|++|+.|++.+
T Consensus         7 s~a~L~G~W~L~~~~~~~~C~l~L~~~~~~~~~g~~l~~~~~C~~~l~~~~p~~W~~~~~g-i~L~~~~G~~v~~f~~~~   85 (106)
T 1jiw_I            7 SASDLAGQWTLQQDEAPAICHLELRDSEVAEASGYDLGGDTACLTRWLPSEPRAWRPTPAG-IALLERGGLTLMLLGRQG   85 (106)
T ss_dssp             CHHHHCEEEEEEETTSSCEEEEEEEEEEEGGGTEEEEEESGGGGGGTSSSCCCEEEEETTE-EEEECTTSCEEEEEEEEE
T ss_pred             CHHHCCCEEEEECCCCCCEEEEEECCCCCCCCCCEEECCCCCCCHHHHCCCCCEEEECCCE-EEEECCCCCEEEEEEECC
T ss_conf             8789275157865899861489974774778763054168684067751786248744998-899868999999988468


Q ss_pred             CCCEECCCCCCCCEEEEEC
Q ss_conf             9732201137896188739
Q gi|254781045|r  144 EQSFEGSFQGESDKVIISR  162 (162)
Q Consensus       144 ~grfeG~t~~~G~pisLsR  162 (162)
                      +|+|++++. +|.+++|.|
T Consensus        86 ~g~~~~~~~-~g~~l~L~R  103 (106)
T 1jiw_I           86 EGDYRVQKG-DGGQLVLRR  103 (106)
T ss_dssp             TTEEEEECS-SSCEEEEEE
T ss_pred             CCCEEEECC-CCCEEEEEE
T ss_conf             972782059-997799995



>1smp_I Erwinia chrysanthemi inhibitor; complex (metalloprotease/inhibitor); 2.30A {Erwinia chrysanthemi} SCOP: b.61.2.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target162 outer membrane lipoprotein omp19 [Candidatus Liberibact
d1jiwi_105 Metalloprotease inhibitor {Pseudomonas aeruginosa, apri 99.07
d1smpi_100 Metalloprotease inhibitor {Erwinia chrysanthemi [TaxId: 97.54
>d1jiwi_ b.61.2.1 (I:) Metalloprotease inhibitor {Pseudomonas aeruginosa, aprin [TaxId: 287]} Back     information, alignment and structure
class: All beta proteins
fold: Streptavidin-like
superfamily: beta-Barrel protease inhibitors
family: Metalloprotease inhibitor
domain: Metalloprotease inhibitor
species: Pseudomonas aeruginosa, aprin [TaxId: 287]
Probab=99.07  E-value=1.8e-10  Score=81.56  Aligned_cols=90  Identities=14%  Similarity=0.364  Sum_probs=78.4

Q ss_pred             CCHHEEEEEEECCCCC--EEEEEEECCCCCCC--CCCCCC-CCCCCH--HCCCCEEECCCCEEEEECCCCCEEEEEEECC
Q ss_conf             7011365788636897--36889713667777--145436-773000--0021003338718999828998799999548
Q gi|254781045|r   71 IRMGIIGAWKVSYRDV--DCKMILTLTRFKKN--FRGTAR-SCHGRL--ASLAAWNIIDEDSFELKNKSGQTIIVFYKTA  143 (162)
Q Consensus        71 ~r~sl~G~W~vs~~g~--sC~v~Lt~t~~~~G--yra~~~-gC~g~L--~~i~aW~v~G~~vl~L~D~sG~~v~~l~~s~  143 (162)
                      +..+|+|.|.++.+.+  .|.|.|+.+.-.+|  |+.... .|...+  +.+.+|...+ +.+.|.++.|+.|+.|.+..
T Consensus         7 s~~~laG~W~l~~~~~~~~C~ltL~~~~~~~g~~~~l~~~~~C~~~~l~~~p~~W~p~p-dgi~L~~a~Gs~l~ff~r~~   85 (105)
T d1jiwi_           7 SASDLAGQWTLQQDEAPAICHLELRDSEVAEASGYDLGGDTACLTRWLPSEPRAWRPTP-AGIALLERGGLTLMLLGRQG   85 (105)
T ss_dssp             CHHHHCEEEEEEETTSSCEEEEEEEEEEEGGGTEEEEEESGGGGGGTSSSCCCEEEEET-TEEEEECTTSCEEEEEEEEE
T ss_pred             CHHHHCCEEEEECCCCCCEEEEEECCCCCCCCCCEECCCCCCHHHHHHCCCCCEEEECC-CEEEEECCCCCEEEEEECCC
T ss_conf             87894552467438888600778468747887502325885634687457871485669-98999769999887720156


Q ss_pred             CCCEECCCCCCCCEEEEEC
Q ss_conf             9732201137896188739
Q gi|254781045|r  144 EQSFEGSFQGESDKVIISR  162 (162)
Q Consensus       144 ~grfeG~t~~~G~pisLsR  162 (162)
                      +++|++.+. +|.++.|-|
T Consensus        86 ~g~y~~~~~-~g~~l~L~R  103 (105)
T d1jiwi_          86 EGDYRVQKG-DGGQLVLRR  103 (105)
T ss_dssp             TTEEEEECS-SSCEEEEEE
T ss_pred             CCEEEEECC-CCCEEEEEE
T ss_conf             870576518-997689874



>d1smpi_ b.61.2.1 (I:) Metalloprotease inhibitor {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target162 outer membrane lipoprotein omp19 [Candidatus Liberibact
1jiw_I_106 Proteinase inhibitor; pseudomonas aeruginosa alkal 98.78
1smp_I_101 Erwinia chrysanthemi inhibitor; complex (metallopr 98.01
>1jiw_I (I:) Proteinase inhibitor; pseudomonas aeruginosa alkaline protease inhibitor, hydrolase/hyrolase inhibitor complex; 1.74A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=98.78  E-value=2e-08  Score=71.43  Aligned_cols=90  Identities=14%  Similarity=0.362  Sum_probs=77.2

Q ss_pred             CCHHEEEEEEECCCCC--EEEEEEECCCCC--CCCCCCCC-CCCCCH--HCCCCEEECCCCEEEEECCCCCEEEEEEECC
Q ss_conf             7011365788636897--368897136677--77145436-773000--0021003338718999828998799999548
Q gi|254781045|r   71 IRMGIIGAWKVSYRDV--DCKMILTLTRFK--KNFRGTAR-SCHGRL--ASLAAWNIIDEDSFELKNKSGQTIIVFYKTA  143 (162)
Q Consensus        71 ~r~sl~G~W~vs~~g~--sC~v~Lt~t~~~--~Gyra~~~-gC~g~L--~~i~aW~v~G~~vl~L~D~sG~~v~~l~~s~  143 (162)
                      +.++|+|.|.+..+.+  .|++.|+.+...  ++|+..-. .|...+  +...+|...+ +.+.|.++.|..|+.|-+.+
T Consensus         7 s~~~LaG~W~l~~~~~~~~C~l~L~~~~~~~~~~~~L~~~~~C~~~~l~~~P~~Wr~~p-dgi~L~~~~Gs~v~ff~r~~   85 (106)
T 1jiw_I            7 SASDLAGQWTLQQDEAPAICHLELRDSEVAEASGYDLGGDTACLTRWLPSEPRAWRPTP-AGIALLERGGLTLMLLGRQG   85 (106)
T ss_dssp             CHHHHCEEEEEEETTSSCEEEEEEEEEEEGGGTEEEEEESGGGGGGTSSSCCCEEEEET-TEEEEECTTSCEEEEEEEEE
T ss_pred             CHHHHCCEEEEECCCCCCEEEEEECCCCCCCCCCEECCCCCCHHHHHHCCCCEEEEECC-CEEEEECCCCCEEEEEECCC
T ss_conf             86890852578558998625889778868776511535773722576346860587649-98999879999988753078


Q ss_pred             CCCEECCCCCCCCEEEEEC
Q ss_conf             9732201137896188739
Q gi|254781045|r  144 EQSFEGSFQGESDKVIISR  162 (162)
Q Consensus       144 ~grfeG~t~~~G~pisLsR  162 (162)
                      +++|+.... +|.+++|-|
T Consensus        86 ~g~~~~~~~-~G~~l~L~R  103 (106)
T 1jiw_I           86 EGDYRVQKG-DGGQLVLRR  103 (106)
T ss_dssp             TTEEEEECS-SSCEEEEEE
T ss_pred             CCCEEECCC-CCCEEEEEE
T ss_conf             871675169-996689985



>1smp_I (I:) Erwinia chrysanthemi inhibitor; complex (metalloprotease/inhibitor); 2.30A {Erwinia chrysanthemi} Back     alignment and structure