254781044

254781044

succinate dehydrogenase iron-sulfur subunit

GeneID in NCBI database:8210067Locus tag:CLIBASIA_04730
Protein GI in NCBI database:254781044Protein Accession:YP_003065457.1
Gene range:+(1046710, 1047489)Protein Length:259aa
Gene description:succinate dehydrogenase iron-sulfur subunit
COG prediction:[C] Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
KEGG prediction:sdhB; succinate dehydrogenase iron-sulfur subunit (EC:1.3.99.1); K00240 succinate dehydrogenase iron-sulfur protein [EC:1.3.99.1]
SEED prediction:Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Butanoate metabolism [PATH:las00650]
Oxidative phosphorylation [PATH:las00190]
Toluene degradation
Subsystem involved in SEED:TCA Cycle;
Succinate dehydrogenase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MVEIMLPKRSRVKRGKIWNAPTGEKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMMLLDRKI
ccEEEcccccccccccccccccccccEEEEEEEEEccccccccEEEEEEEccccccccHHHHHHHHHHcccccEEEEccccccccccEEEEEcccccHHHHccHHHcccccEEEEcccccEEEcccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHccccHHHccccccHHHHccccccHHHHHHHHHHHHHHccc
ccEEEcccccccccccccccccccccEEEEEEEEEcccccccccccEEEEcccccccHHHHHHHHHHHHcccccccccccccccccccEEEEccEEEEHHHcEHHHccccEEEccccccHHHHcccccHHHHHHHHHHccHHHccccccccccccccHHHHHHccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHccccccEEEEEHEHHHHccccccccHHHHHHHHHHHHHHHcc
mveimlpkrsrvkrgkiwnaptgeknlkEYRIyrwnpdnkgnpcmdtyyvdldncgpmvLDGLLYIknkidptltlrrscregicgscgmnidgtntLACVKDMKDIkgaiavyplphmSVIKDLVVDMshfysqhrsiepwlktvspkpakELLQSHEDRQKIDGLYECvmcaccstscpsywwnsdrylgPAILLQAYRWLIDSrdefqgerldnledpfrlyrchtimnctqscpkglnPAKAIAKIKMMLLDRKI
mveimlpkrsrvkrgkiwnaptgeknlkeyriyRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGicgscgmnidgTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRsiepwlktvspKPAKELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMnctqscpkglnpAKAIAKIKMMLLDRKI
MVEIMLPKRSRVKRGKIWNAPTGEKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMMLLDRKI
*VEIM***********************EYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWLK***************DRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMMLLDR**
MVEIMLPKRSRVKRGKIWNAPTGEKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMMLLDRKI
MVEIMLPKRSRVKRGKIWNAPTGEKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMMLLDRKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEIMLPKRSRVKRGKIWNAPTGEKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMMLLDRKI
MVEIMLPKRSRVKRGKIWNAPTGEKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMMLLDRKI
MVEIMLPKRSRVKRGKIWNAPTGEKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMMLLDRKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target259 succinate dehydrogenase iron-sulfur subunit [Candidatus
315122383259 succinate dehydrogenase iron-sulfur subunit [Candidatus 1 1e-137
239833032259 succinate dehydrogenase and fumarate reductase iron-sul 1 1e-123
327188892259 succinate dehydrogenase protein, iron-sulfur subunit [R 1 1e-123
153008289259 succinate dehydrogenase iron-sulfur subunit [Ochrobactr 1 1e-123
190893743259 succinate dehydrogenase, iron-sulfur subunit [Rhizobium 1 1e-123
116254175259 succinate dehydrogenase iron-sulfur subunit [Rhizobium 1 1e-123
227823649259 succinate dehydrogenase iron-sulfur subunit [Sinorhizob 1 1e-123
15889898259 succinate dehydrogenase iron-sulfur subunit [Agrobacter 1 1e-122
222150045259 succinate dehydrogenase iron-sulfur subunit [Agrobacter 1 1e-122
86359475259 succinate dehydrogenase iron-sulfur subunit [Rhizobium 1 1e-122
>gi|315122383|ref|YP_004062872.1| succinate dehydrogenase iron-sulfur subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 259 Back     alignment and organism information
 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 232/259 (89%), Positives = 249/259 (96%)

Query: 1   MVEIMLPKRSRVKRGKIWNAPTGEKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVL 60
           MVEI+LPKRSRVK+GK WNA +G K L+EYRIYRWNPD++ NP +D YYVDLD+CGPMVL
Sbjct: 1   MVEILLPKRSRVKKGKTWNALSGAKRLREYRIYRWNPDDQDNPHIDIYYVDLDDCGPMVL 60

Query: 61  DGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMS 120
           DGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLAC+KDMKDIKG I VYPLPHMS
Sbjct: 61  DGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACIKDMKDIKGIIKVYPLPHMS 120

Query: 121 VIKDLVVDMSHFYSQHRSIEPWLKTVSPKPAKELLQSHEDRQKIDGLYECVMCACCSTSC 180
           VIKDLVVDMS+FY+QHRSIEPWLKTVSPKPAKELLQSH+DRQKIDGLYECVMCACCSTSC
Sbjct: 121 VIKDLVVDMSYFYAQHRSIEPWLKTVSPKPAKELLQSHDDRQKIDGLYECVMCACCSTSC 180

Query: 181 PSYWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKG 240
           PSYWWNSDRYLGPAILLQAYRWL+DSRDE QG+RLDNLEDPFRLYRCHTIMNCTQSCPKG
Sbjct: 181 PSYWWNSDRYLGPAILLQAYRWLVDSRDEGQGDRLDNLEDPFRLYRCHTIMNCTQSCPKG 240

Query: 241 LNPAKAIAKIKMMLLDRKI 259
           LNPAKAIAKIKMM++DRK+
Sbjct: 241 LNPAKAIAKIKMMMVDRKV 259


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|239833032|ref|ZP_04681361.1| succinate dehydrogenase and fumarate reductase iron-sulfur protein [Ochrobactrum intermedium LMG 3301] Length = 259 Back     alignment and organism information
>gi|327188892|gb|EGE56084.1| succinate dehydrogenase protein, iron-sulfur subunit [Rhizobium etli CNPAF512] Length = 259 Back     alignment and organism information
>gi|153008289|ref|YP_001369504.1| succinate dehydrogenase iron-sulfur subunit [Ochrobactrum anthropi ATCC 49188] Length = 259 Back     alignment and organism information
>gi|190893743|ref|YP_001980285.1| succinate dehydrogenase, iron-sulfur subunit [Rhizobium etli CIAT 652] Length = 259 Back     alignment and organism information
>gi|116254175|ref|YP_770013.1| succinate dehydrogenase iron-sulfur subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 259 Back     alignment and organism information
>gi|227823649|ref|YP_002827622.1| succinate dehydrogenase iron-sulfur subunit [Sinorhizobium fredii NGR234] Length = 259 Back     alignment and organism information
>gi|15889898|ref|NP_355579.1| succinate dehydrogenase iron-sulfur subunit [Agrobacterium tumefaciens str. C58] Length = 259 Back     alignment and organism information
>gi|222150045|ref|YP_002551002.1| succinate dehydrogenase iron-sulfur subunit [Agrobacterium vitis S4] Length = 259 Back     alignment and organism information
>gi|86359475|ref|YP_471367.1| succinate dehydrogenase iron-sulfur subunit [Rhizobium etli CFN 42] Length = 259 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target259 succinate dehydrogenase iron-sulfur subunit [Candidatus
PRK05950232 PRK05950, sdhB, succinate dehydrogenase iron-sulfur sub 1e-128
PLN00129276 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone 1e-115
COG0479234 COG0479, FrdB, Succinate dehydrogenase/fumarate reducta 4e-82
PRK12575235 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur 2e-77
TIGR00384220 TIGR00384, dhsB, succinate dehydrogenase and fumarate r 3e-74
PRK12576279 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur 9e-42
PRK12577329 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur 9e-41
PRK12385244 PRK12385, PRK12385, fumarate reductase iron-sulfur subu 9e-37
PRK06259 486 PRK06259, PRK06259, succinate dehydrogenase/fumarate re 1e-30
PRK13552239 PRK13552, frdB, fumarate reductase iron-sulfur subunit; 3e-24
PRK12386251 PRK12386, PRK12386, fumarate reductase iron-sulfur subu 1e-14
KOG3049288 KOG3049, KOG3049, KOG3049, Succinate dehydrogenase, Fe- 1e-102
PRK08640249 PRK08640, sdhB, succinate dehydrogenase iron-sulfur sub 3e-15
PRK07570250 PRK07570, PRK07570, succinate dehydrogenase/fumarate re 3e-08
COG0247 388 COG0247, GlpC, Fe-S oxidoreductase [Energy production a 1e-05
>gnl|CDD|180322 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|177740 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|30827 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|161850 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>gnl|CDD|183604 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|180493 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|184136 PRK13552, frdB, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183491 PRK12386, PRK12386, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|38259 KOG3049, KOG3049, KOG3049, Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181515 PRK08640, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181038 PRK07570, PRK07570, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>gnl|CDD|30596 COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 259 succinate dehydrogenase iron-sulfur subunit [Candidatus
PRK05950235 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 100.0
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provisiona 100.0
PRK12577330 succinate dehydrogenase iron-sulfur subunit; Provisiona 100.0
PRK12385243 fumarate reductase iron-sulfur subunit; Provisional 100.0
PRK13552240 frdB fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK12576311 succinate dehydrogenase iron-sulfur subunit; Provisiona 100.0
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S p 100.0
PRK08640252 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 100.0
PRK12386250 fumarate reductase iron-sulfur subunit; Provisional 100.0
PRK06259 491 succinate dehydrogenase/fumarate reductase iron-sulfur 100.0
KOG3049288 consensus 100.0
PRK07570247 succinate dehydrogenase/fumarate reductase iron-sulfur 100.0
TIGR00384236 dhsB succinate dehydrogenase and fumarate reductase iro 100.0
PRK08493 819 NADH dehydrogenase subunit G; Validated 99.29
PRK07569236 bidirectional hydrogenase complex protein HoxU; Validat 99.05
COG3383 978 Uncharacterized anaerobic dehydrogenase [General functi 99.02
PRK09129 777 NADH dehydrogenase subunit G; Validated 98.81
PRK07860 809 NADH dehydrogenase subunit G; Validated 98.76
PRK08166 858 NADH dehydrogenase subunit G; Validated 98.74
PRK09130 680 NADH dehydrogenase subunit G; Validated 98.62
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 98.52
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. This mod 96.76
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subuni 99.61
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy produ 99.59
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provisional 99.43
COG1139459 Uncharacterized conserved protein containing a ferredox 99.38
PRK11168 400 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; P 99.37
TIGR03379 397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, ana 99.28
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 99.21
COG0247 388 GlpC Fe-S oxidoreductase [Energy production and convers 99.19
PRK05035 725 electron transport complex protein RnfC; Provisional 99.09
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 98.62
PRK00941 779 acetyl-CoA decarbonylase/synthase complex subunit alpha 98.44
cd01916 731 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-C 98.43
COG1152 772 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit 98.39
TIGR00314 795 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsi 98.26
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit A; P 97.9
TIGR0293696 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR 97.82
PRK12387178 formate hydrogenlyase complex iron-sulfur subunit; Prov 97.71
COG1453391 Predicted oxidoreductases of the aldo/keto reductase fa 97.7
CHL00014173 ndhI NADH dehydrogenase subunit I 97.68
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone ox 97.65
PRK05888172 NADH dehydrogenase subunit I; Provisional 97.59
TIGR01971129 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IP 97.59
TIGR02163263 napH_ ferredoxin-type protein, NapH/MauN family; InterP 97.57
TIGR02176 1194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 97.56
PRK09477287 napH quinol dehydrogenase membrane component; Provision 97.52
PRK08222181 hydrogenase 4 subunit H; Validated 97.51
PRK13795630 hypothetical protein; Provisional 97.36
PRK08348111 NADH-plastoquinone oxidoreductase subunit; Provisional 97.29
TIGR02910346 sulfite_red_A sulfite reductase, subunit A; InterPro: I 97.1
TIGR02494 305 PFLE_PFLC glycyl-radical enzyme activating protein fami 97.08
PRK05113184 electron transport complex protein RnfB; Provisional 96.91
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase subuni 96.9
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit delta; R 96.88
KOG3256212 consensus 96.82
TIGR02912323 sulfite_red_C sulfite reductase, subunit C; InterPro: I 96.77
PRK08318413 dihydropyrimidine dehydrogenase; Validated 96.7
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subunit Oor 96.67
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. Membe 96.66
PRK09898208 hypothetical protein; Provisional 96.66
TIGR00402161 napF ferredoxin-type protein NapF; InterPro: IPR004496 96.61
PRK13984 604 putative oxidoreductase; Provisional 96.59
CHL0006581 psaC photosystem I subunit VII 96.51
TIGR00403187 ndhI NADH-plastoquinone oxidoreductase, I subunit; Inte 96.46
PRK0265181 photosystem I subunit VII; Provisional 96.37
PRK10330181 electron transport protein HydN; Provisional 96.37
PRK10882 329 hydrogenase 2 protein HybA; Provisional 96.32
TIGR02745 474 ccoG_rdxA_fixG cytochrome c oxidase accessory protein C 96.29
PRK06991 274 ferredoxin; Provisional 96.27
COG0437203 HybA Fe-S-cluster-containing hydrogenase components 1 [ 96.17
PRK08764138 ferredoxin; Provisional 96.07
TIGR01944213 rnfB electron transport complex, RnfABCDGE type, B subu 95.98
PRK09625130 porD pyruvate flavodoxin oxidoreductase subunit delta; 95.86
COG1149 284 MinD superfamily P-loop ATPase containing an inserted f 95.78
PRK07118276 ferredoxin; Validated 95.6
COG2768354 Uncharacterized Fe-S center protein [General function p 95.58
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 95.45
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 95.27
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Reviewed 95.14
COG114599 NapF Ferredoxin [Energy production and conversion] 95.09
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 94.12
COG114668 Ferredoxin [Energy production and conversion] 93.9
PRK10194164 ferredoxin-type protein; Provisional 93.71
COG1148 622 HdrA Heterodisulfide reductase, subunit A and related p 93.48
TIGR02484 392 CitB CitB domain protein; InterPro: IPR012830 This entr 93.15
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB 91.72
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Reviewed 91.24
COG2221317 DsrA Dissimilatory sulfite reductase (desulfoviridin), 91.14
TIGR00276297 TIGR00276 iron-sulfur cluster binding protein, putative 90.09
TIGR00273450 TIGR00273 iron-sulfur cluster binding protein; InterPro 99.51
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 97.48
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.27
TIGR00314 795 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsi 95.13
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Iron-su 98.3
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 98.21
PRK11433217 putative xanthine dehydrogenase iron-sulfur-binding sub 98.18
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma sub 98.11
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene has be 98.02
CHL0013499 petF ferredoxin; Validated 97.78
PRK05713312 hypothetical protein; Provisional 97.72
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, small 97.64
PRK11872 340 antC anthranilate dioxygenase reductase; Provisional 97.59
PRK07609 337 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated 97.31
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybdenum-b 97.25
PTZ00038172 ferredoxin; Provisional 97.24
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylas 97.24
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 97.17
pfam0011178 Fer2 2Fe-2S iron-sulfur cluster binding domain. Several 96.86
COG0633102 Fdx Ferredoxin [Energy production and conversion] 96.82
TIGR02963 515 xanthine_xdhA xanthine dehydrogenase, small subunit; In 94.19
PTZ00305297 NADH:ubiquinone oxidoreductase; Provisional 91.78
KOG0430 1257 consensus 91.55
TIGR02745 474 ccoG_rdxA_fixG cytochrome c oxidase accessory protein C 97.37
PRK10194164 ferredoxin-type protein; Provisional 96.69
PRK12814652 putative NADPH-dependent glutamate synthase small subun 96.64
PRK09476254 napG quinol dehydrogenase periplasmic component; Provis 96.58
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 96.14
PRK07118276 ferredoxin; Validated 96.02
PRK13984 604 putative oxidoreductase; Provisional 96.0
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 95.95
PRK10882 329 hydrogenase 2 protein HybA; Provisional 95.34
PRK05035 725 electron transport complex protein RnfC; Provisional 93.9
PRK09898208 hypothetical protein; Provisional 93.41
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 91.91
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Reviewed 91.37
cd01916 731 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-C 91.22
PRK09477287 napH quinol dehydrogenase membrane component; Provision 91.07
PRK00941 779 acetyl-CoA decarbonylase/synthase complex subunit alpha 90.96
PRK11749460 putative oxidoreductase; Provisional 90.04
PRK10684335 HCP oxidoreductase, NADH-dependent; Provisional 96.88
PRK09326 346 F420H2 dehydrogenase subunit F; Provisional 96.87
TIGR01582293 FDH-beta formate dehydrogenase, beta subunit; InterPro: 92.89
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S prote 92.17
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the electr 91.32
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron tran 90.8
PRK09800 928 putative selenate reductase subunit YgfN; Provisional 96.72
TIGR02160371 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK 96.13
PRK06273163 ferredoxin; Provisional 96.12
TIGR02700237 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterP 95.5
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein; Int 94.64
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 93.64
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S prote 93.14
PRK09476 254 napG quinol dehydrogenase periplasmic component; Provis 92.81
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy produ 91.57
PRK05802328 hypothetical protein; Provisional 94.34
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 91.29
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>KOG3049 consensus Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein; InterPro: IPR004489 Succinate dehydrogenase and fumarate reductase are reverse directions of the same enzymatic interconversion, succinate + FAD+ = fumarate + FADH2 (1 Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] Back     alignment and domain information
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional Back     alignment and domain information
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated Back     alignment and domain information
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA Back     alignment and domain information
>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit; InterPro: IPR004460 Acetyl-CoA decarbonylase/synthase (ACDS) is a multienzyme complex (carbon monoxide dehydrogenase is a synonym) Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR014283 This entry consists of ferredoxins which are encoded in the nitrogen fixation regions of many nitrogen-fixing bacteria Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IPR010226 This entry represents the I subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family; InterPro: IPR011886 Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase; InterPro: IPR011895 The oxidative decarboxylation of pyruvate to acetyl-CoA, a central step in energy metabolism, can occur by two different mechanisms Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>TIGR02910 sulfite_red_A sulfite reductase, subunit A; InterPro: IPR014259 This entry represents subunit A, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839 This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>KOG3256 consensus Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C; InterPro: IPR014261 This entry represents subunit C, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF; InterPro: IPR004496 Members of this family are the ferredoxin-type protein subunits of nitrate reductase Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase, I subunit; InterPro: IPR004497 NADH-plastoquinone oxidoreductase subunit I (1 Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK10330 electron transport protein HydN; Provisional Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein CcoG; InterPro: IPR014116 Member of this ferredoxin-like protein family, include FixG, CcoG and RdxA, Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit; InterPro: IPR010207 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR02484 CitB CitB domain protein; InterPro: IPR012830 This entry identifies proteins that are decribed as citrate utilization protein B, restricted to the proteobacteria Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR00276 TIGR00276 iron-sulfur cluster binding protein, putative; InterPro: IPR004453 This is a family of putative iron-sulphur cluster binding proteins Back     alignment and domain information
>TIGR00273 TIGR00273 iron-sulfur cluster binding protein; InterPro: IPR004452 Members of this family have a perfect 4Fe-4S binding motif C-x(2)-C-x(2)-C-x(3)-CP followed by either a perfect or imperfect (the first Cys replaced by Ser) second copy Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit; InterPro: IPR004460 Acetyl-CoA decarbonylase/synthase (ACDS) is a multienzyme complex (carbon monoxide dehydrogenase is a synonym) Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PRK11433 putative xanthine dehydrogenase iron-sulfur-binding subunit; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>pfam00111 Fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit; InterPro: IPR014307 Members of this protein are the small subunit (or, in eukaryotes, the N-terminal domain) of xanthine dehydrogenase, an enzyme of purine catabolism via urate Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>KOG0430 consensus Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein CcoG; InterPro: IPR014116 Member of this ferredoxin-like protein family, include FixG, CcoG and RdxA, Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated Back     alignment and domain information
>PRK11749 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit; InterPro: IPR006470 The sequences in this group represent the beta subunit of the gamma-proteobacterial formate dehydrogenase Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PRK09800 putative selenate reductase subunit YgfN; Provisional Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit; InterPro: IPR011884 Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation , Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterPro: IPR014073 This entry describes one of two paralogous families of archaeal flavoprotein Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein; InterPro: IPR004494 MauM ferredoxin-type protein is involved in methylamine utilization Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target259 succinate dehydrogenase iron-sulfur subunit [Candidatus
1yq3_B252 Avian Respiratory Complex Ii With Oxaloacetate And 6e-69
3abv_B252 Crystal Structure Of Porcine Heart Mitochondrial Co 1e-68
1zoy_B252 Crystal Structure Of Mitochondrial Respiratory Comp 1e-68
2wp9_B238 Crystal Structure Of The E. Coli Succinate:quinone 5e-63
1nek_B238 Complex Ii (Succinate Dehydrogenase) From E. Coli W 6e-63
1kf6_B243 E. Coli Quinol-Fumarate Reductase With Bound Inhibi 6e-49
1qlb_B239 Respiratory Complex Ii-Like Fumarate Reductase From 8e-43
2bs2_B241 Quinol:fumarate Reductase From Wolinella Succinogen 1e-42
2fug_9182 Crystal Structure Of The Hydrophilic Domain Of Resp 0.001
>gi|85544001|pdb|1YQ3|B Chain B, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 252 Back     alignment and structure
 Score =  265 bits (676), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 153/244 (62%), Positives = 186/244 (76%), Gaps = 4/244 (1%)

Query: 19  NAPTGEKNLKEYRIYRWNPDNKG-NPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLR 77
            A      +K++ IYRW+PD  G  P M TY VDL+ CGPMVLD L+ IKN++D TLT R
Sbjct: 3   TAAAATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFR 62

Query: 78  RSCREGICGSCGMNIDGTNTLACVKDMKDIKGAIA-VYPLPHMSVIKDLVVDMSHFYSQH 136
           RSCREGICGSC MNI G NTLAC K +         +YPLPHM V+KDLV D+S+FY+Q+
Sbjct: 63  RSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQY 122

Query: 137 RSIEPWLKTVSPKPA--KELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPA 194
           +SIEP+LK         ++ LQS EDRQK+DGLYEC++CACCSTSCPSYWWN D+YLGPA
Sbjct: 123 KSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPA 182

Query: 195 ILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMML 254
           +L+QAYRW+IDSRD++  ERL  L+DPF LYRCHTIMNCT++CPKGLNP KAIA+IK M+
Sbjct: 183 VLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM 242

Query: 255 LDRK 258
              K
Sbjct: 243 ATYK 246


>gi|322812259|pdb|3ABV|B Chain B, Crystal Structure Of Porcine Heart Mitochondrial Complex Ii Bound With N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide Length = 252 Back     alignment and structure
>gi|73535957|pdb|1ZOY|B Chain B, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 252 Back     alignment and structure
>gi|304445589|pdb|2WP9|B Chain B, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhb His207thr Mutant Length = 238 Back     alignment and structure
gi|28948819|pdb|1NEK|B Chain B, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 238 Back     alignment and structure
>gi|20150749|pdb|1KF6|B Chain B, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 243 Back     alignment and structure
gi|6730471|pdb|1QLB|B Chain B, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 239 Back     alignment and structure
>gi|118137365|pdb|2BS2|B Chain B, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 241 Back     alignment and structure
gi|90109660|pdb|2FUG|9 Chain 9, Crystal Structure Of The Hydrophilic Domain Of Respiratory Complex I From Thermus Thermophilus Length = 182 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target259 succinate dehydrogenase iron-sulfur subunit [Candidatus
1kf6_B243 Fumarate reductase iron-sulfur protein; respiration, fu 1e-66
2h88_B252 Succinate dehydrogenase IP subunit; complex II, membran 1e-64
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succinate 2e-59
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S 7e-49
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* Length = 243 Back     alignment and structure
 Score =  248 bits (633), Expect = 1e-66
 Identities = 77/232 (33%), Positives = 119/232 (51%), Gaps = 4/232 (1%)

Query: 24  EKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREG 83
            KNLK   + R+NP+    P    Y V  D     +LD L YIK+ + P L+ R SCR  
Sbjct: 3   MKNLK-IEVVRYNPEVDTAPHSAFYEVPYD-ATTSLLDALGYIKDNLAPDLSYRWSCRMA 60

Query: 84  ICGSCGMNIDGTNTLACVKDMKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWL 143
           ICGSCGM ++    LAC   ++D    + V  L +  + +DLVVDM+HF     +I+P++
Sbjct: 61  ICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYI 120

Query: 144 KTVSPK-PAKELLQSHEDRQKIDGLYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRW 202
              S        +Q+     K      C+ C  C  +CP +  N + ++GPA +  A+R+
Sbjct: 121 IGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPE-FIGPAAITLAHRY 179

Query: 203 LIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMML 254
             DSRD  + ER+  L     ++ C  +  C++ CPK ++PA AI + K+  
Sbjct: 180 NEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVES 231


>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 1zoy_B* 1zp0_B* Length = 252 Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* Length = 238 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target259 succinate dehydrogenase iron-sulfur subunit [Candidatus
1kf6_B243 Fumarate reductase iron-sulfur protein; respiration, fu 100.0
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succinate 100.0
2h88_B252 Succinate dehydrogenase IP subunit; complex II, membran 100.0
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S 100.0
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 4Fe-4 99.11
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron transpo 98.66
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron transpo 97.57
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron- 97.04
1xer_A103 Ferredoxin; electron transport, iron-sulfur, duplicatio 96.97
1jb0_C80 Photosystem I iron-sulfur center; membrane protein, mul 96.6
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, r 96.5
1kqf_B294 FDH-N beta, formate dehydrogenase, nitrate-inducible, i 96.27
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0. 96.26
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4 96.25
2v2k_A105 Ferredoxin; iron, 3Fe-4S, 4Fe-4S, transport, iron-sulfu 96.17
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; electron 96.14
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transport, i 96.08
3cf4_A 807 Acetyl-COA decarbonylase/synthase alpha subunit; methan 96.06
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; NMR { 96.05
1h98_A78 Ferredoxin; electron transport, thermophilic, iron-sulf 95.98
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aromatic 95.94
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer, fla 95.86
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3. 95.75
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR {Therm 95.47
3i9v_1438 NADH-quinone oxidoreductase subunit 1; electron transpo 95.02
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovibrio g 94.75
1dwl_A59 Ferredoxin I; electron transfer, model, heteronuclear d 94.74
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, hexam 94.66
1h0h_B214 Formate dehydrogenase (small subunit); tungsten seleniu 93.9
1dax_A64 Ferredoxin I; electron transport, electron-transfer pro 93.45
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanine din 92.28
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanine din 92.0
2ivf_B 352 Ethylbenzene dehydrogenase beta-subunit; anaerobic hydr 91.83
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolution a 90.91
3hrd_D160 Nicotinate dehydrogenase small FES subunit; selenium li 98.38
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine 97.97
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-helix b 97.96
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD 97.87
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, molybden 97.87
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehydrogen 97.87
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, copper 97.81
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced with di 97.81
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferredoxin, 97.74
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox protein, i 97.72
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protein); 1 97.71
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.7 97.67
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-bin 97.61
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A {Pla 97.57
1awd_A94 Ferredoxin; electron transport, eukaryotic, green ALGA, 97.56
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, ir 97.53
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, electr 97.53
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.20A {E 97.26
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherich 96.96
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondrial; ir 96.89
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, iron, i 96.8
3nrz_A164 Xanthine dehydrogenase/oxidase; xanthine oxidase, hypox 96.79
1b9r_A105 Protein (terpredoxin); structure from molmol, ferredoxi 96.63
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, metal pro 96.56
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-s 96.37
1v97_A 1332 XD, xanthine dehydrogenase; molybdopterin, FYX-051, rea 96.22
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-binding, 95.95
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductas 95.91
1e6e_B128 Adrenodoxin, ADX; flavoenzyme, electron transferase, ox 95.73
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramo 95.6
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkh 97.33
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger su 97.16
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molybdenum 95.49
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membrane pr 94.99
1kqf_B 294 FDH-N beta, formate dehydrogenase, nitrate-inducible, i 95.96
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic hydr 95.24
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1. 95.09
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreductase, 92.25
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* Back     alignment and structure
Probab=100.00  E-value=0  Score=537.76  Aligned_cols=233  Identities=32%  Similarity=0.583  Sum_probs=220.6

Q ss_pred             CCCEEEEEEEEECCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEEECCCCCCCCCCC
Q ss_conf             86079999986368888887368998642678811678999999732876388404567735443031436126632110
Q gi|254781044|r   24 EKNLKEYRIYRWNPDNKGNPCMDTYYVDLDNCGPMVLDGLLYIKNKIDPTLTLRRSCREGICGSCGMNIDGTNTLACVKD  103 (259)
Q Consensus        24 ~~~~~~~~i~R~~p~~~~~~~~~~y~v~~~~~~~tvld~L~~ik~~~D~sl~fr~sCr~giCGsCa~~iNG~~~LAC~t~  103 (259)
                      +.+.++|+||||||+.+.+|||++|+|+++ ++|||||+|++||+++||||+||+|||+||||||||+|||+|+|||+|+
T Consensus         2 em~~v~l~I~R~dp~~d~~~~~~~y~v~~~-~~~tvLd~L~~Ik~~~D~sl~fr~~Cr~~iCGsCam~iNG~~~laC~t~   80 (243)
T 1kf6_B            2 EMKNLKIEVVRYNPEVDTAPHSAFYEVPYD-ATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTF   80 (243)
T ss_dssp             CCEEEEEEEEECCTTTCSSCEEEEEEEEEC-TTCBHHHHHHHHHHHTCTTCCCCCCCSSSSSCCCEEEETTEEEEGGGCB
T ss_pred             CCCEEEEEEEEECCCCCCCCEEEEEEEECC-CCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCEEEECCCCHHHHHCC
T ss_conf             975789999985899899864699997179-9982999999998353897357616888988743689899732324054


Q ss_pred             HHCCCCCEEEEECCCCEEEEEEEEEHHHHHHHHHHHHHCCCCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHCCC
Q ss_conf             000478518986489804411245104799988754210346663-1101112207776544668888873131322820
Q gi|254781044|r  104 MKDIKGAIAVYPLPHMSVIKDLVVDMSHFYSQHRSIEPWLKTVSP-KPAKELLQSHEDRQKIDGLYECVMCACCSTSCPS  182 (259)
Q Consensus       104 ~~~~~~~i~iePl~~~pVikDLvVD~~~~~~~~~~~~p~~~~~~~-~~~~e~~qsped~~~~~~~~~CI~CG~C~saCP~  182 (259)
                      ++++.++++||||++||||||||||+++||+++++++||+.+... .++.+.+|+|+++++++++++||+||+|+++||+
T Consensus        81 i~~~~~~i~iePL~~~pVikDLvVD~s~f~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CI~Cg~C~s~Cp~  160 (243)
T 1kf6_B           81 LRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQ  160 (243)
T ss_dssp             GGGCTTCEEEECCTTSCEEETTEECCHHHHHHHHHTCCSCCSCCCCGGGCCCCCCHHHHHTTGGGGCCCCCCHHHHHCHH
T ss_pred             CCCCCCCCEEEECCCCCEEEEEEECCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHCH
T ss_conf             40002442011236673665677667489999885145014788887622234787799998745540200004641051


Q ss_pred             EEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             0102221011478899988516888431388999622866527676647345518997888999999999998612
Q gi|254781044|r  183 YWWNSDRYLGPAILLQAYRWLIDSRDEFQGERLDNLEDPFRLYRCHTIMNCTQSCPKGLNPAKAIAKIKMMLLDRK  258 (259)
Q Consensus       183 ~~~~~~~flGP~~l~~a~r~~~D~rD~~~~erl~~l~~~~gi~~C~~C~~C~~vCPkgI~~~~~I~~LRr~~v~rk  258 (259)
                      +..++ .|+||++++++|||..|+||..+.+||+.+.+++|+|+|++|++|+++|||||+|+++|+.||+++++..
T Consensus       161 ~~~~~-~f~GP~~~~~a~r~~~D~rd~~~~erl~~~~~~~Gi~~C~~~~~C~~vCPk~I~p~~~I~~lr~~~~~~~  235 (243)
T 1kf6_B          161 FGLNP-EFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDF  235 (243)
T ss_dssp             HHHCT-TSCCHHHHHHHHHHHTCTTCCCTHHHHHHHHSTTTGGGCCCCCHHHHHCTTCCCHHHHHHHHHHHHHHHH
T ss_pred             HHHCC-CCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             13213-4356999998740344640232999999865589920898868812308899998999999999999999



>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 1zoy_B* 1zp0_B* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, 4Fe-4S, iron-sulfur, metal-binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthesis; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 2o01_C* Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>1kqf_B FDH-N beta, formate dehydrogenase, nitrate-inducible, iron- sulfur subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} PDB: 1blu_A 3exy_A Back     alignment and structure
>2v2k_A Ferredoxin; iron, 3Fe-4S, 4Fe-4S, transport, iron-sulfur, mycobacterium tuberculosis, Fe-S cluster, metal-binding, electron transfer; 1.6A {Mycobacterium smegmatis} Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron- sulfur clusters, reduction potential; 1.65A {Escherichia coli k-12} Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>3cf4_A Acetyl-COA decarbonylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductase; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica K172} SCOP: d.58.1.1 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>3i9v_1 NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1* 3m9s_1* Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- bismgd enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Azoarcus SP} Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, copper, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans OM5} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron transport; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 4fxc_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A 2kaj_A 2pvg_C ... Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum 3D7} SCOP: d.15.4.1 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>3nrz_A Xanthine dehydrogenase/oxidase; xanthine oxidase, hypoxanthine, substrate orientation, hydro oxidoreductase; HET: FAD MTE HPA; 1.80A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3eub_A* Back     alignment and structure