254781047

254781047

AFG1-family ATPase

GeneID in NCBI database:8210070Locus tag:CLIBASIA_04745
Protein GI in NCBI database:254781047Protein Accession:YP_003065460.1
Gene range:+(1048492, 1049706)Protein Length:404aa
Gene description:AFG1-family ATPase
COG prediction:[R] Predicted ATPase
KEGG prediction:AFG1-family ATPase; K06916
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
MSLDLVSSRLISLIQDKKLKYNPAQESVVKSFDRLLVDLYKQQKQEQGIFSWLWNLRGIKRKYCSMQGIYLHGDVGQGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKIEFGEILESDPIPLVASSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFIELLEKKLEIISLDSGQDYRRKEQSILPIYMTPLNSYNRVLMDKLWAHITKGKKSLSLNISTEGGYEIHVPFFCSRVSRFSFFDLCDRPLSANDFVEIANRFDVVIINDIPLLKEDRKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKIIIDACKILLSNKSVNDFFNNSKFLI
cccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccccccccccEEEEccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHccEEEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEccccHHHHccccccHHHHHHHHHHHHHHcEEEEccccccccccccccccEEcccccHHHHHHHHHHHHHHccccccccccEEEEcccEEEEEEEEccEEEEEHHHHHcccccHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHcccEEEEEccccHHHHccccccccHHHHHHHHHHHHHHHcHHHHHHHHcccccccccccccccccccccccccc
ccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccccccccccEEEEEcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcEEEccHccHcHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHccccHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHccccEEcccccHHHHHHHHHHHHHHHcccccccccEEEEcccccEcHHHcccEEEEEHHHHccccccHHHHHHHHHHccEEEEcccccccHccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHcHHHHHHHHHHccccHHcHcccccEcc
MSLDLVSSRLISLIQdkklkynpaqesVVKSFDRLLVDLYKQQKQEQGIFSWLWNLRGIKRkycsmqgiylhgdvgqGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKiefgeilesdpiplvaSSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIivmtsnfipenlykdeinRNVLVSFIELLEKKLEIISldsgqdyrrkeqsilpiymtplnsyNRVLMDKLWAHITKgkkslslnisteggyeihvpffcsrvsrfsffdlcdrplsandfVEIANRFDvviindipllkeDRKDWIKRFIMLIDVFYEHKIgliisseeniedlfpyklrkgaFEIQRTVSRLYEMFSAQYIGKNKIIIDACKILLsnksvndffnnskfli
MSLDLVSSRLISLiqdkklkynpaqesVVKSFDRLLVDLYKQQKQEQGIFSWLWNLRGIKRKYCSMQGIYLHGDVGQGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKIEFGEILESDPIPLVASSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFIELLEKKLEiisldsgqdyrRKEQSILPIYMTPLNSYNRVLMDKLWAHITKGKKSLSLNISTEGGYEIHVPFFCSRVSRFSFFDLCDRPLSANDFVEIANrfdvviindipllkedrKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKIIIDACKILLsnksvndffnnskfli
MSLDLVSSRLISLIQDKKLKYNPAQESVVKSFDRLLVDLYKQQKQEQGIFSWLWNLRGIKRKYCSMQGIYLHGDVGQGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKIEFGEILESDPIPLVASSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFiellekkleiiSLDSGQDYRRKEQSILPIYMTPLNSYNRVLMDKLWAHITKGKKSLSLNISTEGGYEIHVPffcsrvsrfsffDLCDRPLSANDFVEIANRFDVVIINDIPLLKEDRKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKIIIDACKILLSNKSVNDFFNNSKFLI
***DLVSSRLISLIQDKKLKYNPAQESVVKSFDRLLVDLYKQQK********************SMQGIYLHGDVGQGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYR**********SDPIPLVASSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFIELLEKKLEIISLDSGQDYRRKEQSILPIYMTPLNSYNRVLMDKLWAHITK**********TEGGYEIHVPFFCSRVSRFSFFDLCDRPLSANDFVEIANRFDVVIINDIPLLKEDRKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKII************VNDFFNNSKFLI
MSLDLVSSRLISLIQDKKLKYNPAQESVVKSFDRLLVDLYKQQKQEQGIFSWLWNLRGIKRKYCSMQGIYLHGDVGQGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKIEFGEILESDPIPLVASSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFIELLEKKLEIISLDSGQDYRRKEQSILPIYMTPLNSYNRVLMDKLWAHITKGKKSLSLNISTEGGYEIHVPFFCSRVSRFSFFDLCDRPLSANDFVEIANRFDVVIINDIPLLKEDRKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKIIIDACKILLSNKSVNDFFNNSKFLI
***DLVSSRLISLIQDKKLKYNPAQESVVKSFDRLLVDLYKQQKQEQGIFSWLWNLRGIKRKYCSMQGIYLHGDVGQGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKIEFGEILESDPIPLVASSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFIELLEKKLEIISLDSGQDYRRKEQSILPIYMTPLNSYNRVLMDKLWAHITKGKKSLSLNISTEGGYEIHVPFFCSRVSRFSFFDLCDRPLSANDFVEIANRFDVVIINDIPLLKEDRKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKIIIDACKILLSNKSVNDFFNNSKFLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLDLVSSRLISLIQDKKLKYNPAQESVVKSFDRLLVDLYKQQKQEQGIFSWLWNLRGIKRKYCSMQGIYLHGDVGQGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKIEFGEILESDPIPLVASSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFIELLEKKLEIISLDSGQDYRRKEQSILPIYMTPLNSYNRVLMDKLWAHITKGKKSLSLNISTEGGYEIHVPFFCSRVSRFSFFDLCDRPLSANDFVEIANRFDVVIINDIPLLKEDRKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKIIIDACKILLSNKSVNDFFNNSKFLI
MSLDLVSSRLISLIQDKKLKYNPAQESVVKSFDRLLVDLYKQQKQEQGIFSWLWNLRGIKRKYCSMQGIYLHGDVGQGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKIEFGEILESDPIPLVASSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFIELLEKKLEIISLDSGQDYRRKEQSILPIYMTPLNSYNRVLMDKLWAHITKGKKSLSLNISTEGGYEIHVPFFCSRVSRFSFFDLCDRPLSANDFVEIANRFDVVIINDIPLLKEDRKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKIIIDACKILLSNKSVNDFFNNSKFLI
MSLDLVSSRLISLIQDKKLKYNPAQESVVKSFDRLLVDLYKQQKQEQGIFSWLWNLRGIKRKYCSMQGIYLHGDVGQGKSMLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKIEFGEILESDPIPLVASSIALESRVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFIELLEKKLEIISLDSGQDYRRKEQSILPIYMTPLNSYNRVLMDKLWAHITKGKKSLSLNISTEGGYEIHVPFFCSRVSRFSFFDLCDRPLSANDFVEIANRFDVVIINDIPLLKEDRKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKIIIDACKILLSNKSVNDFFNNSKFLI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target404 AFG1-family ATPase [Candidatus Liberibacter asiaticus s
315122385312 AFG1-family ATPase [Candidatus Liberibacter solanacearu 1 1e-123
241206659387 AFG1-family ATPase [Rhizobium leguminosarum bv. trifoli 1 1e-94
209551258386 AFG1-family ATPase [Rhizobium leguminosarum bv. trifoli 1 1e-94
116254172387 hypothetical protein RL4440 [Rhizobium leguminosarum bv 1 8e-94
218675177387 putative ATP-binding protein [Rhizobium etli GR56] Leng 1 1e-93
327188900387 putative ATP-binding protein [Rhizobium etli CNPAF512] 1 1e-92
190893740387 ATP-binding protein [Rhizobium etli CIAT 652] Length = 1 7e-92
325294009387 ATP-binding protein [Agrobacterium sp. H13-3] Length = 1 9e-92
159185306387 hypothetical protein Atu2640 [Agrobacterium tumefaciens 1 1e-91
86359473387 putative ATP-binding protein [Rhizobium etli CFN 42] Le 1 6e-91
>gi|315122385|ref|YP_004062874.1| AFG1-family ATPase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 312 Back     alignment and organism information
 Score =  444 bits (1143), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 214/311 (68%), Positives = 260/311 (83%)

Query: 81  MLMNLFFALVPIEKKCRLHFYEFMKDVHSRIIMYRKKIEFGEILESDPIPLVASSIALES 140
           MLMNLFF L P EKKC+ HFYEFMKDVH RII +RK+IE G I ESDPIPLVA+SIA E 
Sbjct: 1   MLMNLFFELAPTEKKCKRHFYEFMKDVHCRIIFHRKQIESGAIRESDPIPLVANSIASEV 60

Query: 141 RVLCFDEFMITNIADAIILSRLFAALFSHGCIIVMTSNFIPENLYKDEINRNVLVSFIEL 200
            +LCFDEFM+TNIADA+ILSRLF+ LF  GC++V+TSNFIP+NLYKDEINR+V + FI +
Sbjct: 61  NLLCFDEFMVTNIADAVILSRLFSELFLRGCVVVVTSNFIPDNLYKDEINRDVFMPFINI 120

Query: 201 LEKKLEIISLDSGQDYRRKEQSILPIYMTPLNSYNRVLMDKLWAHITKGKKSLSLNISTE 260
           L+K+LE+ISLDSGQDYRR+++ ILP+YM+PL+S+   LM+KLW H+ KG++SL LNIS +
Sbjct: 121 LKKELEVISLDSGQDYRRRKEKILPLYMSPLDSHTETLMNKLWDHMRKGQESLVLNISAK 180

Query: 261 GGYEIHVPFFCSRVSRFSFFDLCDRPLSANDFVEIANRFDVVIINDIPLLKEDRKDWIKR 320
           GGY+IHVP    RVSRFSFFDLCDR  SANDFVEIA RFDVV I++IP LK DRKDWI+R
Sbjct: 181 GGYKIHVPSSFKRVSRFSFFDLCDRSFSANDFVEIAMRFDVVFIDNIPFLKGDRKDWIRR 240

Query: 321 FIMLIDVFYEHKIGLIISSEENIEDLFPYKLRKGAFEIQRTVSRLYEMFSAQYIGKNKII 380
           FIMLIDVFYE+KI LI+SSE +I + F  +L    FE QRT+SRL+EMFS QY+ K+KI+
Sbjct: 241 FIMLIDVFYEYKICLIVSSEVDINNFFYDQLGTENFEFQRTISRLFEMFSVQYVSKHKIV 300

Query: 381 IDACKILLSNK 391
           +DA K+LL NK
Sbjct: 301 MDAYKLLLLNK 311


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241206659|ref|YP_002977755.1| AFG1-family ATPase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 387 Back     alignment and organism information
>gi|209551258|ref|YP_002283175.1| AFG1-family ATPase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 386 Back     alignment and organism information
>gi|116254172|ref|YP_770010.1| hypothetical protein RL4440 [Rhizobium leguminosarum bv. viciae 3841] Length = 387 Back     alignment and organism information
>gi|218675177|ref|ZP_03524846.1| putative ATP-binding protein [Rhizobium etli GR56] Length = 387 Back     alignment and organism information
>gi|327188900|gb|EGE56092.1| putative ATP-binding protein [Rhizobium etli CNPAF512] Length = 387 Back     alignment and organism information
>gi|190893740|ref|YP_001980282.1| ATP-binding protein [Rhizobium etli CIAT 652] Length = 387 Back     alignment and organism information
>gi|325294009|ref|YP_004279873.1| ATP-binding protein [Agrobacterium sp. H13-3] Length = 387 Back     alignment and organism information
>gi|159185306|ref|NP_355577.2| hypothetical protein Atu2640 [Agrobacterium tumefaciens str. C58] Length = 387 Back     alignment and organism information
>gi|86359473|ref|YP_471365.1| putative ATP-binding protein [Rhizobium etli CFN 42] Length = 387 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target404 AFG1-family ATPase [Candidatus Liberibacter asiaticus s
pfam03969361 pfam03969, AFG1_ATPase, AFG1-like ATPase 5e-78
KOG2383467 KOG2383, KOG2383, KOG2383, Predicted ATPase [General fu 5e-74
COG1485367 COG1485, COG1485, Predicted ATPase [General function pr 4e-92
>gnl|CDD|112768 pfam03969, AFG1_ATPase, AFG1-like ATPase Back     alignment and domain information
>gnl|CDD|37594 KOG2383, KOG2383, KOG2383, Predicted ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31674 COG1485, COG1485, Predicted ATPase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 404 AFG1-family ATPase [Candidatus Liberibacter asiaticus s
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 100.0
COG1485367 Predicted ATPase [General function prediction only] 100.0
KOG2383467 consensus 100.0
PRK08939306 primosomal protein DnaI; Reviewed 99.52
PRK08116262 hypothetical protein; Validated 99.46
COG1484254 DnaC DNA replication protein [DNA replication, recombin 99.15
PRK06526254 transposase; Provisional 99.05
PRK09183258 transposase/IS protein; Provisional 99.03
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 99.02
PRK08181269 transposase; Validated 98.96
PRK07952242 DNA replication protein DnaC; Validated 98.94
PRK06835330 DNA replication protein DnaC; Validated 98.87
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 98.82
PRK12377248 putative replication protein; Provisional 98.78
PRK06921265 hypothetical protein; Provisional 98.72
PRK06893229 DNA replication initiation factor; Validated 98.7
KOG0733 802 consensus 98.27
CHL00176631 ftsH cell division protein; Validated 98.14
KOG0727408 consensus 98.07
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 97.99
PRK04195403 replication factor C large subunit; Provisional 97.89
KOG0730 693 consensus 97.88
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 97.87
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 97.67
KOG0733802 consensus 97.63
KOG0651388 consensus 97.62
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 97.53
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 97.49
PRK10865 857 protein disaggregation chaperone; Provisional 97.45
PRK12402337 replication factor C small subunit 2; Reviewed 97.36
PRK13342417 recombination factor protein RarA; Reviewed 97.3
PRK00440318 rfc replication factor C small subunit; Reviewed 97.23
PRK13341 726 recombination factor protein RarA/unknown domain fusion 96.72
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 96.7
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 96.67
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 96.61
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational modi 96.35
TIGR00362493 DnaA chromosomal replication initiator protein DnaA; In 96.26
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 96.02
KOG0728404 consensus 95.88
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 95.7
KOG2028554 consensus 95.65
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 95.58
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 95.44
PRK11608325 pspF phage shock protein operon transcriptional activat 95.4
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 95.36
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 95.34
pfam05621302 TniB Bacterial TniB protein. This family consists of se 95.27
KOG2004 906 consensus 95.17
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 95.11
PRK05022510 anaerobic nitric oxide reductase transcription regulato 95.08
KOG0731774 consensus 94.83
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 94.35
PRK13531 498 regulatory ATPase RavA; Provisional 94.29
PRK10365441 transcriptional regulatory protein ZraR; Provisional 94.19
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 94.14
PRK05917290 DNA polymerase III subunit delta'; Validated 94.05
PRK07399314 DNA polymerase III subunit delta'; Validated 93.99
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 93.9
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 93.08
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 92.8
KOG1514767 consensus 92.63
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 92.42
KOG2227529 consensus 92.24
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 92.18
PRK08058329 DNA polymerase III subunit delta'; Validated 92.06
PRK08769319 DNA polymerase III subunit delta'; Validated 91.95
COG2204464 AtoC Response regulator containing CheY-like receiver, 91.67
PRK05564313 DNA polymerase III subunit delta'; Validated 90.82
KOG0989346 consensus 90.53
PRK06090319 DNA polymerase III subunit delta'; Validated 90.32
PRK00149447 dnaA chromosomal replication initiation protein; Review 99.18
PRK12422455 chromosomal replication initiation protein; Provisional 99.15
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.96
PRK05642234 DNA replication initiation factor; Validated 98.94
PRK08084235 DNA replication initiation factor; Provisional 98.92
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.92
PRK08903227 hypothetical protein; Validated 98.81
PRK08727233 hypothetical protein; Validated 98.72
PRK03992390 proteasome-activating nucleotidase; Provisional 98.69
CHL00195491 ycf46 Ycf46; Provisional 98.68
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 98.63
PRK09087226 hypothetical protein; Validated 98.36
PRK06620214 hypothetical protein; Validated 98.36
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 98.19
pfam00004131 AAA ATPase family associated with various cellular acti 97.96
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 97.84
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.79
KOG0730693 consensus 97.73
pfam07726131 AAA_3 ATPase family associated with various cellular ac 97.71
COG0714329 MoxR-like ATPases [General function prediction only] 97.59
smart00382148 AAA ATPases associated with a variety of cellular activ 97.57
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 97.34
KOG0732 1080 consensus 97.3
KOG0742630 consensus 97.22
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.16
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 97.1
KOG1051898 consensus 97.08
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 97.07
CHL00095 823 clpC Clp protease ATP binding subunit 97.0
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 96.9
pfam00931285 NB-ARC NB-ARC domain. 96.52
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 96.5
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.36
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 96.23
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 96.18
PHA02244383 ATPase-like protein 95.89
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 95.73
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 95.65
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 95.62
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 95.45
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 95.35
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 95.3
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 95.24
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 95.2
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.18
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 95.04
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 95.01
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 95.0
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 94.86
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 94.84
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 94.61
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 94.45
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 94.3
PRK04841 903 transcriptional regulator MalT; Provisional 94.21
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 94.21
CHL00095823 clpC Clp protease ATP binding subunit 93.91
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 93.53
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 93.5
KOG2543438 consensus 93.44
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 93.33
PRK10865857 protein disaggregation chaperone; Provisional 93.12
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 92.84
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 92.64
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 91.68
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 91.6
KOG0735952 consensus 97.67
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 97.1
KOG0737386 consensus 96.87
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 96.84
KOG0729435 consensus 96.76
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 96.61
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 96.51
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 96.27
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 96.1
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 95.85
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.8
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 95.66
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.64
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.57
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.41
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 95.38
KOG0741 744 consensus 95.37
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.36
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 95.29
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.23
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.02
KOG0739439 consensus 94.86
KOG0738491 consensus 94.83
cd01124187 KaiC KaiC is a circadian clock protein primarily found 94.83
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 94.62
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 94.55
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 94.46
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 94.44
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 94.31
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 94.13
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 94.13
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 93.97
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 93.43
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 93.33
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 93.13
KOG1803 649 consensus 93.04
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 92.98
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 92.87
KOG0740428 consensus 92.86
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 92.7
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 92.21
KOG0743457 consensus 91.95
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 91.93
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 91.91
TIGR00150147 TIGR00150 conserved hypothetical protein TIGR00150; Int 91.84
PRK13407334 bchI magnesium chelatase subunit I; Provisional 91.79
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 91.21
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 91.13
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 90.97
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 90.58
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 90.42
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 90.41
KOG0736953 consensus 97.55
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 93.45
KOG0734752 consensus 97.26
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 96.71
KOG0744423 consensus 97.19
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 95.99
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.1
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 90.89
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 97.19
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 93.04
PRK06921265 hypothetical protein; Provisional 97.1
PRK08116262 hypothetical protein; Validated 96.86
pfam03969 361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 96.55
PRK05642234 DNA replication initiation factor; Validated 95.68
PRK00149 447 dnaA chromosomal replication initiation protein; Review 95.68
PRK06835330 DNA replication protein DnaC; Validated 95.07
PRK07952242 DNA replication protein DnaC; Validated 94.96
PRK12422 455 chromosomal replication initiation protein; Provisional 94.94
PRK08084235 DNA replication initiation factor; Provisional 94.82
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 94.31
pfam00308219 Bac_DnaA Bacterial dnaA protein. 93.62
PRK08903227 hypothetical protein; Validated 91.36
TIGR02759613 TraD_Ftype type IV conjugative transfer system coupling 90.49
KOG0652424 consensus 96.72
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 94.43
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 94.26
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 92.14
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 91.69
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.37
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 95.77
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.14
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 93.04
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 96.09
smart00487201 DEXDc DEAD-like helicases superfamily. 96.04
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 93.29
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 92.53
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.98
KOG0726440 consensus 95.6
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.53
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 95.42
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 95.22
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 95.03
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.38
PRK13549513 xylose transporter ATP-binding subunit; Provisional 94.37
cd03234226 ABCG_White The White subfamily represents ABC transport 93.79
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 93.36
PRK03695245 vitamin B12-transporter ATPase; Provisional 93.27
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 93.25
pfam06745231 KaiC KaiC. This family represents a conserved region wi 92.27
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 92.15
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 91.83
PRK10876 1181 recB exonuclease V subunit beta; Provisional 91.58
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.28
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 94.28
PRK13544208 consensus 94.14
>pfam03969 AFG1_ATPase AFG1-like ATPase Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG2383 consensus Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>pfam01695 IstB IstB-like ATP binding protein Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0733 consensus Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0727 consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>KOG0730 consensus Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0733 consensus Back     alignment and domain information
>KOG0651 consensus Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937 Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>pfam00158 Sigma54_activat Sigma-54 interaction domain Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA; InterPro: IPR001957 The bacterial dnaA protein , , plays an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR005938 The ATPase Cdc48 is required for membrane fusion and protein degradation Back     alignment and domain information
>KOG0728 consensus Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2028 consensus Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK07270 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>pfam05621 TniB Bacterial TniB protein Back     alignment and domain information
>KOG2004 consensus Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252 This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>KOG0731 consensus Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251 This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO) Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1514 consensus Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2227 consensus Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0989 consensus Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>pfam00308 Bac_DnaA Bacterial dnaA protein Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08903 hypothetical protein; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>pfam07728 AAA_5 AAA domain (dynein-related subfamily) Back     alignment and domain information
>pfam00004 AAA ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0730 consensus Back     alignment and domain information
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>pfam00910 RNA_helicase RNA helicase Back     alignment and domain information
>KOG0732 consensus Back     alignment and domain information
>KOG0742 consensus Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051 consensus Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>pfam07724 AAA_2 AAA domain (Cdc48 subfamily) Back     alignment and domain information
>pfam00931 NB-ARC NB-ARC domain Back     alignment and domain information
>pfam05673 DUF815 Protein of unknown function (DUF815) Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2543 consensus Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>KOG0735 consensus Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0737 consensus Back     alignment and domain information
>pfam01637 Arch_ATPase Archaeal ATPase Back     alignment and domain information
>KOG0729 consensus Back     alignment and domain information
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>KOG0741 consensus Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>KOG0739 consensus Back     alignment and domain information
>KOG0738 consensus Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>pfam00270 DEAD DEAD/DEAH box helicase Back     alignment and domain information
>pfam09848 DUF2075 Uncharacterized conserved protein (DUF2075) Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277 This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>KOG1803 consensus Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>KOG0740 consensus Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>KOG0743 consensus Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI Back     alignment and domain information
>TIGR00150 TIGR00150 conserved hypothetical protein TIGR00150; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein' Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase; InterPro: IPR013380 Proteins in this entry are found in a variety of bacteria, and are predicted to be ATPases involved in type III secretion systems Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>KOG0736 consensus Back     alignment and domain information
>pfam08298 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG0734 consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO Back     alignment and domain information
>KOG0744 consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR005938 The ATPase Cdc48 is required for membrane fusion and protein degradation Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>pfam03969 AFG1_ATPase AFG1-like ATPase Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>pfam00308 Bac_DnaA Bacterial dnaA protein Back     alignment and domain information
>PRK08903 hypothetical protein; Validated Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD; InterPro: IPR014128 The TraD protein performs an essential coupling function in conjugative type IV secretion systems Back     alignment and domain information
>KOG0652 consensus Back     alignment and domain information
>PRK06674 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information