254781048

254781048

malate dehydrogenase

GeneID in NCBI database:8210071Locus tag:CLIBASIA_04750
Protein GI in NCBI database:254781048Protein Accession:YP_003065461.1
Gene range:+(1049743, 1050705)Protein Length:320aa
Gene description:malate dehydrogenase
COG prediction:[C] Malate/lactate dehydrogenases
KEGG prediction:mdh; malate dehydrogenase (EC:1.1.1.37); K00024 malate dehydrogenase [EC:1.1.1.37]
SEED prediction:Malate dehydrogenase (EC 1.1.1.37)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Pyruvate metabolism [PATH:las00620]
Glyoxylate and dicarboxylate metabolism [PATH:las00630]
Methane metabolism [PATH:las00680]
Subsystem involved in SEED:TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MKSNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICITNPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAIAIAESYLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCNSCTKLVPSLV
ccccEEEEEcccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHcccccccEEEccccHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccccHHHEEEEccHHHHHHHHHHHHHHHcccHHHEEEEEEEcccccEEEEEEEEEEccEEHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccEEEEEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccEEEEEcccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccHHHHccccEEEEEccHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHcccHHHEEEccHHHHHHHHHHHHHHHHcccHHHEEccEEEccHHHEEEcHHHcEEccEEHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEEEEccEHHHEcccEEEEEEEEEccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccccc
MKSNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIvdgmprgkaldiaesspvegfgaqlcgtsdysdiaeADVCIVtagiprkpsmsrdDLLADNLKAIEKVGAGirkyapnsfvICITNPLDAMVWALQKfsglpshmvVGMAGILDSARFRYFLAQEFGVSVESVTALVLgshgdsmvPMLRYAtvsgipvsdlvklgwtTQEKIDQIVKRTREGGAEIVGLLRsgsayyapassAIAIAESYLKNkknllpcaahlsgqygvegfYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCnsctklvpslv
MKSNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTagiprkpsmsrdDLLADNLKAIEKVGAGIRKYAPNSFVICITNPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAIAIAESYLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCNSCTKLVPSLV
MKSNKIALIGSGMIGGTLAHLAvlkklgdvvlldivdgMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICITNPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRsgsayyapassaiaiaesyLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCNSCTKLVPSLV
**SNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICITNPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAIAIAESYLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCNSCTKLVPSLV
MKSNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICITNPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAIAIAESYLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCNSCTKLVPSLV
**SNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICITNPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAIAIAESYLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCNSCTKLVPSLV
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICITNPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAIAIAESYLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCNSCTKLVPSLV
MKSNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICITNPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAIAIAESYLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCNSCTKLVPSLV
MKSNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQLCGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICITNPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSMVPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAIAIAESYLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQKSVKATVDLCNSCTKLVPSLV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target320 malate dehydrogenase [Candidatus Liberibacter asiaticus
315122386320 malate dehydrogenase [Candidatus Liberibacter solanacea 1 1e-163
110635723321 malate dehydrogenase [Mesorhizobium sp. BNC1] Length = 1 1e-136
222150042320 malate dehydrogenase [Agrobacterium vitis S4] Length = 1 1e-135
17982015326 malate dehydrogenase [Brucella melitensis bv. 1 str. 16 1 1e-134
161511165320 malate dehydrogenase [Brucella melitensis bv. 1 str. 16 1 1e-133
239833054326 malate dehydrogenase, NAD-dependent [Ochrobactrum inter 1 1e-133
225628127326 malate dehydrogenase, NAD-dependent [Brucella ceti str. 1 1e-133
148560281320 malate dehydrogenase [Brucella ovis ATCC 25840] Length 1 1e-133
306843378320 malate dehydrogenase, NAD-dependent [Brucella sp. BO1] 1 1e-133
163843950320 malate dehydrogenase [Brucella suis ATCC 23445] Length 1 1e-133
>gi|315122386|ref|YP_004062875.1| malate dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 320 Back     alignment and organism information
 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/319 (88%), Positives = 301/319 (94%)

Query: 1   MKSNKIALIGSGMIGGTLAHLAVLKKLGDVVLLDIVDGMPRGKALDIAESSPVEGFGAQL 60
           MKSNKIALIGSGMIGGTLAHL+ LK LGDVVLLDIVDGMPRGKALDIA+SSPVE F  +L
Sbjct: 1   MKSNKIALIGSGMIGGTLAHLSALKNLGDVVLLDIVDGMPRGKALDIAQSSPVEDFDGKL 60

Query: 61  CGTSDYSDIAEADVCIVTAGIPRKPSMSRDDLLADNLKAIEKVGAGIRKYAPNSFVICIT 120
           CGTSDY+DIA ADVCIVTAGIPRKPSMSRDDLL+DNLK+IEKV  GIR+YAP+SFVICIT
Sbjct: 61  CGTSDYADIAGADVCIVTAGIPRKPSMSRDDLLSDNLKSIEKVAEGIRQYAPHSFVICIT 120

Query: 121 NPLDAMVWALQKFSGLPSHMVVGMAGILDSARFRYFLAQEFGVSVESVTALVLGSHGDSM 180
           NPLDAMVWALQKFSGLPSHMVVGMAG+LDSARFRYFLAQE GVSVESVTALVLGSHGDSM
Sbjct: 121 NPLDAMVWALQKFSGLPSHMVVGMAGVLDSARFRYFLAQELGVSVESVTALVLGSHGDSM 180

Query: 181 VPMLRYATVSGIPVSDLVKLGWTTQEKIDQIVKRTREGGAEIVGLLRSGSAYYAPASSAI 240
           +PMLRYATVSGIPV DLVKLGW+T+EKIDQIVKRTRE GAEIVGLLRSGSAYY+PASSAI
Sbjct: 181 IPMLRYATVSGIPVLDLVKLGWSTKEKIDQIVKRTREAGAEIVGLLRSGSAYYSPASSAI 240

Query: 241 AIAESYLKNKKNLLPCAAHLSGQYGVEGFYVGVPVVIGHKGVEKIVELNLSFDEKDAFQK 300
           A+AESYL+NKKNL PCAAHLSGQY V GFYVGVPV+IGH GVEKIVEL+LS DEKD F+K
Sbjct: 241 AMAESYLRNKKNLFPCAAHLSGQYDVNGFYVGVPVIIGHGGVEKIVELDLSSDEKDDFKK 300

Query: 301 SVKATVDLCNSCTKLVPSL 319
           SVKATVDLCN+CT+LV SL
Sbjct: 301 SVKATVDLCNACTRLVSSL 319


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110635723|ref|YP_675931.1| malate dehydrogenase [Mesorhizobium sp. BNC1] Length = 321 Back     alignment and organism information
>gi|222150042|ref|YP_002550999.1| malate dehydrogenase [Agrobacterium vitis S4] Length = 320 Back     alignment and organism information
>gi|17982015|gb|AAL51319.1| malate dehydrogenase [Brucella melitensis bv. 1 str. 16M] Length = 326 Back     alignment and organism information
>gi|161511165|ref|NP_539055.2| malate dehydrogenase [Brucella melitensis bv. 1 str. 16M] Length = 320 Back     alignment and organism information
>gi|239833054|ref|ZP_04681383.1| malate dehydrogenase, NAD-dependent [Ochrobactrum intermedium LMG 3301] Length = 326 Back     alignment and organism information
>gi|225628127|ref|ZP_03786162.1| malate dehydrogenase, NAD-dependent [Brucella ceti str. Cudo] Length = 326 Back     alignment and organism information
>gi|148560281|ref|YP_001259751.1| malate dehydrogenase [Brucella ovis ATCC 25840] Length = 320 Back     alignment and organism information
>gi|306843378|ref|ZP_07475979.1| malate dehydrogenase, NAD-dependent [Brucella sp. BO1] Length = 320 Back     alignment and organism information
>gi|163843950|ref|YP_001628354.1| malate dehydrogenase [Brucella suis ATCC 23445] Length = 320 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target320 malate dehydrogenase [Candidatus Liberibacter asiaticus
PRK06223307 PRK06223, PRK06223, malate dehydrogenase; Reviewed 1e-143
PTZ00082321 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provisiona 1e-117
PTZ00117319 PTZ00117, PTZ00117, malate dehydrogenase; Provisional 1e-110
TIGR01763305 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dep 1e-101
COG0039313 COG0039, Mdh, Malate/lactate dehydrogenases [Energy pro 4e-96
cd00300300 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes 9e-71
cd05291306 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogen 1e-67
TIGR01771299 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase 4e-64
cd05292308 cd05292, LDH_2, A subgroup of L-lactate dehydrogenases 5e-62
PRK00066315 PRK00066, ldh, L-lactate dehydrogenase; Reviewed 7e-58
cd05294309 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenases-li 1e-50
KOG1495332 KOG1495, KOG1495, KOG1495, Lactate dehydrogenase [Energ 1e-48
cd05290307 cd05290, LDH_3, A subgroup of L-lactate dehydrogenases 3e-46
cd05293312 cd05293, LDH_1, A subgroup of L-lactate dehydrogenases 2e-44
PLN02602350 PLN02602, PLN02602, lactate dehydrogenase 2e-41
cd00650263 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydroge 4e-40
cd01337310 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and 5e-24
KOG1494345 KOG1494, KOG1494, KOG1494, NAD-dependent malate dehydro 7e-23
cd00704323 cd00704, MDH, Malate dehydrogenase 6e-20
TIGR01772312 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-d 6e-19
PLN00106323 PLN00106, PLN00106, malate dehydrogenase 7e-18
PTZ00325321 PTZ00325, PTZ00325, malate dehydrogenase; Provisional 2e-17
PRK05086312 PRK05086, PRK05086, malate dehydrogenase; Provisional 3e-13
cd01339300 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like mal 1e-139
pfam02866173 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha 2e-30
pfam00056142 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, NAD b 1e-24
pfam03721185 pfam03721, UDPG_MGDP_dh_N, UDP-glucose/GDP-mannose dehy 0.001
TIGR01759323 TIGR01759, MalateDH-SF1, malate dehydrogenase 2e-16
cd01336325 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic and cyt 6e-16
cd01338322 cd01338, MDH_choloroplast_like, Chloroplast-like malate 2e-15
KOG1496332 KOG1496, KOG1496, KOG1496, Malate dehydrogenase [Energy 3e-12
PRK05442326 PRK05442, PRK05442, malate dehydrogenase; Provisional 9e-12
PLN00135309 PLN00135, PLN00135, malate dehydrogenase 3e-10
TIGR01758324 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD-depen 2e-11
TIGR01757387 TIGR01757, Malate-DH_plant, malate dehydrogenase, NADP- 4e-08
PLN00112444 PLN00112, PLN00112, malate dehydrogenase (NADP); Provis 9e-08
TIGR01756313 TIGR01756, LDH_protist, lactate dehydrogenase 1e-07
TIGR03026411 TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase 3e-05
COG1250307 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid m 0.002
cd05297423 cd05297, GH4_alpha_glucosidase_galactosidase, Glycoside 0.003
>gnl|CDD|180477 PRK06223, PRK06223, malate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173376 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173409 PTZ00117, PTZ00117, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162521 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|30388 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|133418 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>gnl|CDD|133427 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|162525 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|133428 cd05292, LDH_2, A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|178836 PRK00066, ldh, L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|133430 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>gnl|CDD|36708 KOG1495, KOG1495, KOG1495, Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|133426 cd05290, LDH_3, A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|133429 cd05293, LDH_1, A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|178212 PLN02602, PLN02602, lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>gnl|CDD|36707 KOG1494, KOG1494, KOG1494, NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|133420 cd00704, MDH, Malate dehydrogenase Back     alignment and domain information
>gnl|CDD|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|177723 PLN00106, PLN00106, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|173524 PTZ00325, PTZ00325, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|179928 PRK05086, PRK05086, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>gnl|CDD|111722 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain Back     alignment and domain information
>gnl|CDD|143841 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|146385 pfam03721, UDPG_MGDP_dh_N, UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain Back     alignment and domain information
>gnl|CDD|130820 TIGR01759, MalateDH-SF1, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|133421 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>gnl|CDD|133423 cd01338, MDH_choloroplast_like, Chloroplast-like malate dehydrogenases Back     alignment and domain information
>gnl|CDD|36709 KOG1496, KOG1496, KOG1496, Malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180084 PRK05442, PRK05442, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177744 PLN00135, PLN00135, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|130819 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|130818 TIGR01757, Malate-DH_plant, malate dehydrogenase, NADP-dependent Back     alignment and domain information
>gnl|CDD|177727 PLN00112, PLN00112, malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>gnl|CDD|130817 TIGR01756, LDH_protist, lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|163112 TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase Back     alignment and domain information
>gnl|CDD|31442 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|133433 cd05297, GH4_alpha_glucosidase_galactosidase, Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 320 malate dehydrogenase [Candidatus Liberibacter asiaticus
TIGR01771302 L-LDH-NAD L-lactate dehydrogenase; InterPro: IPR011304 100.0
PTZ00082322 L-lactate dehydrogenase; Provisional 100.0
PTZ00117313 malate dehydrogenase; Provisional 100.0
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 100.0
PRK06223312 malate dehydrogenase; Reviewed 100.0
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 100.0
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 100.0
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 100.0
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 100.0
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 100.0
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 100.0
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 100.0
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 100.0
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 100.0
KOG1495332 consensus 100.0
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 100.0
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 100.0
PTZ00325313 malate dehydrogenase; Provisional 100.0
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 100.0
PRK05086312 malate dehydrogenase; Provisional 100.0
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 100.0
PRK05442325 malate dehydrogenase; Provisional 100.0
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 100.0
TIGR01772379 MDH_euk_gproteo malate dehydrogenase, NAD-dependent; In 100.0
TIGR01759329 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 100.0
KOG1494345 consensus 100.0
TIGR01758325 MDH_euk_cyt malate dehydrogenase, NAD-dependent; InterP 100.0
cd04510334 consensus 100.0
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like prot 100.0
KOG1496332 consensus 100.0
TIGR01756314 LDH_protist lactate dehydrogenase; InterPro: IPR011272 100.0
TIGR01757390 Malate-DH_plant malate dehydrogenase, NADP-dependent; I 99.97
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolase 99.88
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; P 99.87
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 4. G 99.87
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, 99.85
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- 99.85
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 94.31
pfam02866173 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-term 100.0
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 100.0
pfam02056183 Glyco_hydro_4 Family 4 glycosyl hydrolase. 99.6
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.61
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.61
PRK08268 503 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.59
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.57
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.53
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 98.52
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 98.51
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.49
PRK07660283 consensus 98.44
PRK09117282 consensus 98.41
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 98.38
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 98.35
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] 98.32
PRK11154706 fadJ multifunctional fatty acid oxidation complex subun 98.3
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.29
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 98.27
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 98.24
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 98.23
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 98.22
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.0
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 97.99
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 97.89
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 97.83
PRK08229341 2-dehydropantoate 2-reductase; Provisional 97.81
PRK06249313 2-dehydropantoate 2-reductase; Provisional 97.8
COG2085211 Predicted dinucleotide-binding enzymes [General functio 97.79
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.74
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+ 97.69
KOG2666481 consensus 97.69
PRK08507275 prephenate dehydrogenase; Validated 97.67
PRK07417280 arogenate dehydrogenase; Reviewed 97.64
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 97.62
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.6
PRK05708305 2-dehydropantoate 2-reductase; Provisional 97.58
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF; InterPro: 97.58
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 97.48
PRK12921306 2-dehydropantoate 2-reductase; Provisional 97.39
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.36
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 97.29
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 97.26
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 97.23
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 97.19
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 97.17
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.15
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 97.08
PRK13303265 L-aspartate dehydrogenase; Provisional 97.01
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 97.01
PRK08251248 short chain dehydrogenase; Provisional 97.0
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 96.99
KOG2304298 consensus 96.94
PRK13302271 putative L-aspartate dehydrogenase; Provisional 96.94
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.91
PRK13940414 glutamyl-tRNA reductase; Provisional 96.88
PRK08324676 short chain dehydrogenase; Validated 96.86
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 96.76
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 96.7
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 96.67
PRK07454241 short chain dehydrogenase; Provisional 96.65
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.62
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 96.61
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 96.6
PRK12862 761 malic enzyme; Reviewed 96.59
PRK08643256 acetoin reductase; Validated 96.57
PRK00421 459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 96.47
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 96.44
PRK07232 753 malic enzyme; Reviewed 96.44
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.43
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.35
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.34
PRK08269311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.32
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.3
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.29
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 96.23
PRK07102243 short chain dehydrogenase; Provisional 96.21
PRK09330387 cell division protein FtsZ; Validated 96.2
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.2
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 96.18
PRK07024256 short chain dehydrogenase; Provisional 96.17
PRK07074256 short chain dehydrogenase; Provisional 96.15
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 96.09
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.99
PRK12550272 shikimate 5-dehydrogenase; Reviewed 95.98
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 95.97
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.87
PRK09072262 short chain dehydrogenase; Provisional 95.86
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.83
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 95.8
PRK06720169 hypothetical protein; Provisional 95.8
PRK08340259 glucose-1-dehydrogenase; Provisional 95.8
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of malic enz 95.77
pfam03949255 Malic_M Malic enzyme, NAD binding domain. 95.77
TIGR02440 732 FadJ fatty oxidation complex, alpha subunit FadJ; Inter 95.67
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic enzym 95.62
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.59
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.53
PRK07041240 short chain dehydrogenase; Provisional 95.52
TIGR02964270 xanthine_xdhC xanthine dehydrogenase accessory protein 95.48
PRK08300298 acetaldehyde dehydrogenase; Validated 95.46
KOG1205282 consensus 95.43
PRK05599246 hypothetical protein; Provisional 95.42
PRK12861 762 malic enzyme; Reviewed 95.41
cd02201304 FtsZ_type1 FtsZ is a GTPase that is similar to the euka 95.4
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of malic enz 95.39
PRK05876275 short chain dehydrogenase; Provisional 95.28
PRK06346251 consensus 95.26
PRK05650270 short chain dehydrogenase; Provisional 95.21
PRK06181263 short chain dehydrogenase; Provisional 95.2
PRK10675338 UDP-galactose-4-epimerase; Provisional 95.19
PRK07775275 short chain dehydrogenase; Provisional 95.15
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 95.14
PRK07060245 short chain dehydrogenase; Provisional 95.11
PRK07814263 short chain dehydrogenase; Provisional 95.06
PRK05867253 short chain dehydrogenase; Provisional 95.05
KOG2711372 consensus 95.04
PRK13529563 malate dehydrogenase; Provisional 94.98
PRK09134256 short chain dehydrogenase; Provisional 94.87
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 94.79
TIGR00065365 ftsZ cell division protein FtsZ; InterPro: IPR000158 In 94.72
PRK06057255 short chain dehydrogenase; Provisional 94.68
COG0281432 SfcA Malic enzyme [Energy production and conversion] 94.64
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.63
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.62
PRK06139324 short chain dehydrogenase; Provisional 94.61
PRK12829264 short chain dehydrogenase; Provisional 94.54
PRK07890258 short chain dehydrogenase; Provisional 94.49
PRK08945245 short chain dehydrogenase; Provisional 94.46
PRK11728 400 hypothetical protein; Provisional 94.43
PRK06198268 short chain dehydrogenase; Provisional 94.33
PRK12824245 acetoacetyl-CoA reductase; Provisional 94.32
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 94.31
cd02191303 FtsZ FtsZ is a GTPase that is similar to the eukaryotic 94.3
PRK06180277 short chain dehydrogenase; Provisional 94.24
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 94.14
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 94.1
PRK07067256 sorbitol dehydrogenase; Provisional 94.09
KOG1208314 consensus 94.09
PRK08219226 short chain dehydrogenase; Provisional 94.02
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 94.0
PRK05866290 short chain dehydrogenase; Provisional 93.97
COG2344211 AT-rich DNA-binding protein [General function predictio 93.97
PRK05872296 short chain dehydrogenase; Provisional 93.89
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 93.88
PRK06179270 short chain dehydrogenase; Provisional 93.88
PRK08862227 short chain dehydrogenase; Provisional 93.87
PRK01368 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.84
PRK07326235 short chain dehydrogenase; Provisional 93.83
PRK07707239 consensus 93.81
PRK07825273 short chain dehydrogenase; Provisional 93.63
TIGR01809291 Shik-DH-AROM shikimate-5-dehydrogenase; InterPro: IPR01 93.62
PRK07856254 short chain dehydrogenase; Provisional 93.58
PRK05875277 short chain dehydrogenase; Provisional 93.57
PRK07479252 consensus 93.49
PRK06138252 short chain dehydrogenase; Provisional 93.47
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 93.46
PRK06125259 short chain dehydrogenase; Provisional 93.46
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). 93.44
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 93.33
PRK08703239 short chain dehydrogenase; Provisional 93.3
PRK07677254 short chain dehydrogenase; Provisional 93.18
PRK07831261 short chain dehydrogenase; Provisional 93.16
TIGR02197353 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; 92.96
PRK07062265 short chain dehydrogenase; Provisional 92.88
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 92.81
PRK07063259 short chain dehydrogenase; Provisional 92.73
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 92.58
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.53
PRK06523260 short chain dehydrogenase; Provisional 92.44
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 92.41
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 92.18
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 92.14
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 91.94
PRK08265261 short chain dehydrogenase; Provisional 91.9
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 91.77
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 91.68
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 91.53
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 91.52
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 91.43
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 91.38
PRK06914280 short chain dehydrogenase; Provisional 91.28
PRK06124259 gluconate 5-dehydrogenase; Provisional 91.22
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 91.22
PRK07035252 short chain dehydrogenase; Provisional 91.21
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 91.06
PRK06101241 short chain dehydrogenase; Provisional 90.9
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 90.89
PRK12939250 short chain dehydrogenase; Provisional 90.77
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 90.72
PRK08085254 gluconate 5-dehydrogenase; Provisional 90.65
PRK07576260 short chain dehydrogenase; Provisional 90.63
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 90.59
PRK03562615 glutathione-regulated potassium-efflux system protein K 90.56
PRK08339263 short chain dehydrogenase; Provisional 90.52
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 90.5
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 90.48
COG1160 444 Predicted GTPases [General function prediction only] 90.33
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 90.31
PRK06718202 precorrin-2 dehydrogenase; Reviewed 90.22
PRK09242258 tropinone reductase; Provisional 90.2
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 90.11
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 90.05
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 98.76
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.03
TIGR01915233 npdG NADPH-dependent F420 reductase; InterPro: IPR01018 97.4
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 96.96
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 96.93
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 96.81
PRK08223287 hypothetical protein; Validated 96.76
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 96.68
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 96.58
PRK09496455 trkA potassium transporter peripheral membrane componen 96.58
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 96.53
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 96.5
KOG1502327 consensus 95.76
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 95.66
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 95.62
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio 95.33
PRK06194301 hypothetical protein; Provisional 94.96
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 94.96
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 94.53
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 94.35
KOG0069336 consensus 94.01
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 93.05
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 92.54
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 91.05
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 98.5
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 97.33
PRK12439340 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; P 97.82
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.31
PRK06046326 alanine dehydrogenase; Validated 97.2
pfam02423312 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin 97.1
PRK08291330 ornithine cyclodeaminase; Validated 97.03
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.0
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 96.99
PRK06545357 prephenate dehydrogenase; Validated 96.96
PRK06199379 ornithine cyclodeaminase; Validated 96.89
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.89
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.84
PRK08040337 putative semialdehyde dehydrogenase; Provisional 96.81
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 96.8
PRK07680273 late competence protein ComER; Validated 96.8
PRK09496 455 trkA potassium transporter peripheral membrane componen 96.78
PRK06141313 ornithine cyclodeaminase; Validated 96.74
PRK08618325 ornithine cyclodeaminase; Validated 96.74
PRK07589346 ornithine cyclodeaminase; Validated 96.64
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 96.63
PRK08655 441 prephenate dehydrogenase; Provisional 96.54
PRK06407302 ornithine cyclodeaminase; Provisional 96.48
PRK06823315 ornithine cyclodeaminase; Validated 96.47
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 96.46
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 96.43
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 96.19
PRK07340304 ornithine cyclodeaminase; Validated 96.16
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 96.14
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 96.11
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 95.98
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 95.95
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 95.77
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin homol 95.71
PRK07208 474 hypothetical protein; Provisional 95.68
PRK13018387 cell division protein FtsZ; Provisional 95.4
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 95.38
PRK11559295 garR tartronate semialdehyde reductase; Provisional 95.37
PRK11749460 putative oxidoreductase; Provisional 95.17
PRK06940277 short chain dehydrogenase; Provisional 95.14
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 95.12
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 94.87
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 94.66
PRK13984604 putative oxidoreductase; Provisional 94.65
PRK11579346 putative oxidoreductase; Provisional 94.63
COG2910211 Putative NADH-flavin reductase [General function predic 94.32
COG0565242 LasT rRNA methylase [Translation, ribosomal structure a 94.29
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 94.25
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 94.23
TIGR02441740 fa_ox_alpha_mit fatty acid oxidation complex, alpha sub 94.14
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 94.13
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 93.81
TIGR01296350 asd_B aspartate-semialdehyde dehydrogenase; InterPro: I 93.79
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 93.77
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 93.73
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 93.63
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 93.57
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 93.36
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 93.26
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 92.96
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 92.66
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 92.58
PRK10206345 putative dehydrogenase; Provisional 92.49
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 92.48
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 91.79
CHL00194319 ycf39 Ycf39; Provisional 91.75
KOG4777361 consensus 91.27
PRK08818373 prephenate dehydrogenase; Provisional 91.11
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 90.97
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 90.68
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transport and 90.51
PRK00048265 dihydrodipicolinate reductase; Provisional 90.1
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 97.71
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 97.35
COG1086588 Predicted nucleoside-diphosphate sugar epimerases [Cell 97.34
PRK05855582 short chain dehydrogenase; Validated 96.51
PRK07832272 short chain dehydrogenase; Provisional 96.41
PRK07201663 short chain dehydrogenase; Provisional 95.32
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 95.3
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 91.24
TIGR02279 508 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC; I 97.43
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 97.19
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.81
pfam00899134 ThiF ThiF family. This family contains a repeated domai 96.76
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 96.75
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.68
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 96.6
PRK07411390 hypothetical protein; Validated 96.54
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 96.44
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Validated 96.36
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 96.27
PRK05600370 thiamine biosynthesis protein ThiF; Validated 96.24
PRK08328230 hypothetical protein; Provisional 96.21
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 96.03
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 95.88
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 95.8
PRK09880343 L-idonate 5-dehydrogenase; Provisional 95.43
PRK12480330 D-lactate dehydrogenase; Provisional 95.29
PRK07236386 hypothetical protein; Provisional 95.23
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 95.15
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 95.09
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3. 94.99
COG1179263 Dinucleotide-utilizing enzymes involved in molybdopteri 94.89
PRK12770350 putative glutamate synthase subunit beta; Provisional 94.89
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 94.72
PRK06153393 hypothetical protein; Provisional 94.61
PRK06847375 hypothetical protein; Provisional 94.44
PRK06436303 glycerate dehydrogenase; Provisional 94.33
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 94.22
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 93.92
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 93.92
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 93.92
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 93.6
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 93.38
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APP 93.26
PRK07045388 putative monooxygenase; Reviewed 93.24
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 93.07
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of amino a 92.97
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 92.89
PRK08013400 hypothetical protein; Provisional 92.76
PRK08163396 salicylate hydroxylase; Provisional 92.72
PRK06753373 hypothetical protein; Provisional 92.5
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 92.5
PRK06834 488 hypothetical protein; Provisional 92.49
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 92.42
KOG2013 603 consensus 92.19
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 92.15
COG2072 443 TrkA Predicted flavoprotein involved in K+ transport [I 91.69
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 91.55
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 91.47
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 91.27
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB; InterPro: 91.25
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 91.13
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 91.12
KOG2018430 consensus 91.11
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 90.96
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 90.81
PRK11259377 solA N-methyltryptophan oxidase; Provisional 90.8
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Provision 90.74
PRK09126392 hypothetical protein; Provisional 90.68
PTZ00318 514 NADH dehydrogenase; Provisional 90.67
PRK06475400 salicylate hydroxylase; Provisional 90.61
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 90.39
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 90.38
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 90.33
PRK05249 465 soluble pyridine nucleotide transhydrogenase; Provision 90.26
PRK06185409 hypothetical protein; Provisional 90.1
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 90.03
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 96.99
TIGR02371327 ala_DH_arch alanine dehydrogenase; InterPro: IPR012742 96.53
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.29
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.21
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 95.87
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 95.29
KOG1430361 consensus 95.23
pfam0262996 CoA_binding CoA binding domain. This domain has a Rossm 93.12
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 91.98
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 96.13
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 96.08
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 94.78
PRK10083339 putative dehydrogenase; Provisional 93.22
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 91.42
pfam11975231 Glyco_hydro_4C Family 4 glycosyl hydrolase C-terminal d 95.6
PRK06487317 glycerate dehydrogenase; Provisional 95.24
PRK08605332 D-lactate dehydrogenase; Validated 94.8
pfam04016229 DUF364 Domain of unknown function (DUF364). Archaeal do 93.75
PRK07574385 formate dehydrogenase; Provisional 93.36
pfam03059277 NAS Nicotianamine synthase protein. Nicotianamine synth 93.69
PRK10792288 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 92.05
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 90.38
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase; InterPro: IPR011304 This entry represents the NAD-dependent L-lactate dehydrogenases from bacteria and eukaryotes Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent; InterPro: IPR011275 This entry contains bacterial and archaeal malate dehydrogenases, which convert malate into oxaloacetate in the citric acid cycle Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>KOG1495 consensus Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent; InterPro: IPR010097 This entry represents the NAD-dependent malate dehydrogenase found in eukaryotes and certain gamma proteobacteria Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 Malate dehydrogenases catalyse the interconversion of malate and oxaloacetate using dinucleotide cofactors Back     alignment and domain information
>KOG1494 consensus Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent; InterPro: IPR011274 This entry represents the NAD-dependent cytosolic malate dehydrogenase from eukaryotes Back     alignment and domain information
>cd04510 consensus Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>KOG1496 consensus Back     alignment and domain information
>TIGR01756 LDH_protist lactate dehydrogenase; InterPro: IPR011272 This entry represents a family of protist (Trichomonad) lactate dehydrogenases which have apparently evolved from a recent protist malate dehydrogenase ancestor Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent; InterPro: IPR011273 This entry represents the NADP-dependent malate dehydrogenase found in plants, mosses and green algae and localised to the chloroplast Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: IPR005676 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>pfam02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain Back     alignment and domain information
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>pfam02056 Glyco_hydro_4 Family 4 glycosyl hydrolase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information