254781057

254781057

hypothetical protein CLIBASIA_04795

GeneID in NCBI database:8210080Locus tag:CLIBASIA_04795
Protein GI in NCBI database:254781057Protein Accession:YP_003065470.1
Gene range:+(1061886, 1062017)Protein Length:43aa
Gene description:hypothetical protein
COG prediction:[R] Phage-related lysozyme (muraminidase)
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40---
MNGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGSC
cccHHHHHHHHHHHHHHHccEEEEEEEcccccEEEEccccccc
cccHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEccccccc
MNGSSKILNALIEITKRYEGlkltayrdpggtwtigyghsgsc
MNGSSKILNALIEITKRYEglkltayrdpggtwtigyghsgsc
MNGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGSC
**********LIEITKRYEGLKLTAYRDPGGTWTIGYGHS***
MNGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGSC
***SSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGH****
ooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
ooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGSC
MNGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGSC
MNGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGSC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
254781056 171 phage-related lysozyme [Candidatus Liberibacter as 9e-11
>gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Back     alignment
 Score = 56.2 bits (134), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 6/48 (12%)

Query: 1  MNGSSK-----ILNALIEITKRYEGLKLTAYRDP-GGTWTIGYGHSGS 42
          MNG  K     + NALI++ K +EGL+LTAYRD  GG WTIGYGH+GS
Sbjct: 17 MNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS 64

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
254781056 171 phage-related lysozyme [Candidatus Liberibacter asiatic 1 1e-06
332877433 147 phage lysozyme [Capnocytophaga sp. oral taxon 329 str. 1 2e-05
330996229 171 phage lysozyme [Paraprevotella xylaniphila YIT 11841] L 1 7e-05
322435593 150 glycoside hydrolase family 24 [Acidobacterium sp. MP5AC 1 1e-04
315122328102 phage-related lysozyme [Candidatus Liberibacter solanac 1 2e-04
31512178854 phage-related lysozyme [Candidatus Liberibacter solanac 1 2e-04
299138984 146 Lysozyme [Acidobacterium sp. MP5ACTX8] Length = 146 1 2e-04
315122565133 phage-related lysozyme [Candidatus Liberibacter solanac 1 2e-04
315122498 146 phage-related lysozyme [Candidatus Liberibacter solanac 1 2e-04
307825053 239 Lysozyme [Methylobacter tundripaludum SV96] Length = 23 1 2e-04
>gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Back     alignment and organism information
 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 6/48 (12%)

Query: 1  MNGSSK-----ILNALIEITKRYEGLKLTAYRDP-GGTWTIGYGHSGS 42
          MNG  K     + NALI++ K +EGL+LTAYRD  GG WTIGYGH+GS
Sbjct: 17 MNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS 64


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332877433|ref|ZP_08445180.1| phage lysozyme [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 147 Back     alignment and organism information
>gi|330996229|ref|ZP_08320119.1| phage lysozyme [Paraprevotella xylaniphila YIT 11841] Length = 171 Back     alignment and organism information
>gi|322435593|ref|YP_004217805.1| glycoside hydrolase family 24 [Acidobacterium sp. MP5ACTX9] Length = 150 Back     alignment and organism information
>gi|315122328|ref|YP_004062817.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 Back     alignment and organism information
>gi|315121788|ref|YP_004062277.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 54 Back     alignment and organism information
>gi|299138984|ref|ZP_07032161.1| Lysozyme [Acidobacterium sp. MP5ACTX8] Length = 146 Back     alignment and organism information
>gi|315122565|ref|YP_004063054.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 133 Back     alignment and organism information
>gi|315122498|ref|YP_004062987.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 146 Back     alignment and organism information
>gi|307825053|ref|ZP_07655274.1| Lysozyme [Methylobacter tundripaludum SV96] Length = 239 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
COG3772 152 COG3772, COG3772, Phage-related lysozyme (muraminidase) 1e-07
cd00737133 cd00737, endolysin_autolysin, Endolysins and autolysins 1e-08
>gnl|CDD|33567 COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|29561 cd00737, endolysin_autolysin, Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
cd00737133 endolysin_autolysin Endolysins and autolysins are found 99.65
COG3772 152 Phage-related lysozyme (muraminidase) [General function 99.64
cd00735 164 bacteriophage_T4-like_lysozyme Bacteriophage T4-like ly 98.92
cd00442105 lysozyme_like lysozyme_like domain. This contains sever 93.18
>cd00737 endolysin_autolysin Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information
>COG3772 Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>cd00735 bacteriophage_T4-like_lysozyme Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls Back     alignment and domain information
>cd00442 lysozyme_like lysozyme_like domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
1xjt_A 191 Crystal Structure Of Active Form Of P1 Phage Endoly 2e-08
1xju_A 163 Crystal Structure Of Secreted Inactive Form Of P1 P 1e-07
2anv_A 146 Crystal Structure Of P22 Lysozyme Mutant L86m Lengt 6e-07
176l_A 164 Protein Flexibility And Adaptability Seen In 25 Cry 0.004
239l_A 164 The Response Of T4 Lysozyme To Large-To-Small Subst 0.004
3oe0_A 499 Crystal Structure Of The Cxcr4 Chemokine Receptor I 0.004
>gi|60594000|pdb|1XJT|A Chain A, Crystal Structure Of Active Form Of P1 Phage Endolysin Lyz Length = 191 Back     alignment and structure
 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 20/39 (51%)

Query: 2  NGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHS 40
          NG+ +   A +E+    EG +   Y  P G WT G G++
Sbjct: 25 NGNVRTNQAGLELIGNAEGCRRDPYXCPAGVWTDGIGNT 63


>gi|60594001|pdb|1XJU|A Chain A, Crystal Structure Of Secreted Inactive Form Of P1 Phage Endolysin Lyz Length = 163 Back     alignment and structure
>gi|90108744|pdb|2ANV|A Chain A, Crystal Structure Of P22 Lysozyme Mutant L86m Length = 146 Back     alignment and structure
>gi|1065176|pdb|176L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834496|pdb|239L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|310689930|pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
1xjt_A 191 Lysozyme; open conformation, hydrolase; HET: CIT; 1.75A 8e-09
1swy_A 164 Lysozyme; RB+ binding sites, AB initio direct methods, 6e-08
1xju_A 163 Lysozyme; secreted inactive conformation, hydrolase; 1. 1e-07
2anv_A 146 Lysozyme; direct methods, lanthinide binding sites, hyd 2e-07
3hde_A 165 Lysozyme; antimicrobial, bacteriolytic enzyme, glycosid 1e-06
3hdf_A 140 Lysozyme; antimicrobial, bacteriolytic enzyme, glycosid 5e-06
2o4w_A 171 Lysozyme; protein folding, protein stability, protein e 2e-04
2qb0_B 241 Telsam domain - lysozyme chimera; helical polymer, hydr 5e-04
>1xjt_A Lysozyme; open conformation, hydrolase; HET: CIT; 1.75A {Enterobacteria phage P1} SCOP: d.2.1.3 Length = 191 Back     alignment and structure
 Score = 54.0 bits (129), Expect = 8e-09
 Identities = 13/38 (34%), Positives = 19/38 (50%)

Query: 2  NGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGH 39
          NG+ +   A +E+    EG +   Y  P G WT G G+
Sbjct: 25 NGNVRTNQAGLELIGNAEGCRRDPYMCPAGVWTDGIGN 62


>1swy_A Lysozyme; RB+ binding sites, AB initio direct methods, hydrolase; 1.06A {Enterobacteria phage T4} SCOP: d.2.1.3 PDB: 1swz_A 1sx2_A 1sx7_A 3fad_A 3f9l_A 2nzn_A 3c8s_A 3cdr_A 2nzb_A 3c8q_A 3c7w_A 3cdq_A 3f8v_A 1l34_A 3c7y_A 2lzm_A 1t6h_A* 1lyd_A 3lzm_A 4lzm_A ... Length = 164 Back     alignment and structure
>1xju_A Lysozyme; secreted inactive conformation, hydrolase; 1.07A {Enterobacteria phage P1} SCOP: d.2.1.3 Length = 163 Back     alignment and structure
>2anv_A Lysozyme; direct methods, lanthinide binding sites, hydrolase; 1.04A {Enterobacteria phage P22} PDB: 2anx_A Length = 146 Back     alignment and structure
>3hde_A Lysozyme; antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase, late protein; 1.95A {Enterobacteria phage P21} Length = 165 Back     alignment and structure
>3hdf_A Lysozyme; antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase, late protein; 1.70A {Enterobacteria phage P21} Length = 140 Back     alignment and structure
>2o4w_A Lysozyme; protein folding, protein stability, protein engineering, hydrolase; 1.90A {Enterobacteria phage T4} Length = 171 Back     alignment and structure
>2qb0_B Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli} Length = 241 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
1xjt_A 191 Lysozyme; open conformation, hydrolase; HET: CIT; 1.75A 99.69
2anv_A 146 Lysozyme; direct methods, lanthinide binding sites, hyd 99.62
1xju_A 163 Lysozyme; secreted inactive conformation, hydrolase; 1. 99.56
1swy_A 164 Lysozyme; RB+ binding sites, AB initio direct methods, 99.25
3hde_A 165 Lysozyme; antimicrobial, bacteriolytic enzyme, glycosid 99.22
3hdf_A 140 Lysozyme; antimicrobial, bacteriolytic enzyme, glycosid 99.16
2qb0_B 241 Telsam domain - lysozyme chimera; helical polymer, hydr 99.15
2o4w_A 171 Lysozyme; protein folding, protein stability, protein e 98.35
>1xjt_A Lysozyme; open conformation, hydrolase; HET: CIT; 1.75A {Enterobacteria phage P1} SCOP: d.2.1.3 Back     alignment and structure
Probab=99.69  E-value=3.7e-18  Score=107.18  Aligned_cols=40  Identities=33%  Similarity=0.563  Sum_probs=37.8

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCEECCCCCEEEECCCCC
Q ss_conf             8530343999999997528512430378997066202666
Q gi|254781057|r    2 NGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSG   41 (43)
Q Consensus         2 ~g~~kis~a~i~lIk~~EG~r~~aY~d~~G~wTIGyGHTg   41 (43)
                      ++.+++|+++++|||.|||+|++||+||+|+||||||||.
T Consensus        25 ~~~~~~S~~g~~lIk~~EG~r~~~Y~D~~G~~TIGyGht~   64 (191)
T 1xjt_A           25 NGNVRTNQAGLELIGNAEGCRRDPYMCPAGVWTDGIGNTH   64 (191)
T ss_dssp             HTCCCCCHHHHHHHHHHHCCEEEEEECSSCCEEEETTBCS
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCEEEECCCC
T ss_conf             8766308999999999758826436888989678356057



>2anv_A Lysozyme; direct methods, lanthinide binding sites, hydrolase; 1.04A {Enterobacteria phage P22} PDB: 2anx_A Back     alignment and structure
>1xju_A Lysozyme; secreted inactive conformation, hydrolase; 1.07A {Enterobacteria phage P1} SCOP: d.2.1.3 Back     alignment and structure
>1swy_A Lysozyme; RB+ binding sites, AB initio direct methods, hydrolase; 1.06A {Enterobacteria phage T4} SCOP: d.2.1.3 PDB: 1swz_A 1sx2_A 1sx7_A 3fad_A 3f9l_A 2nzn_A 3c8s_A 3cdr_A 2nzb_A 3c8q_A 3c7w_A 3cdq_A 3f8v_A 1l34_A 3c7y_A 2lzm_A 1t6h_A* 1lyd_A 3lzm_A 4lzm_A ... Back     alignment and structure
>3hde_A Lysozyme; antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase, late protein; 1.95A {Enterobacteria phage P21} Back     alignment and structure
>3hdf_A Lysozyme; antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase, late protein; 1.70A {Enterobacteria phage P21} Back     alignment and structure
>2qb0_B Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli} Back     alignment and structure
>2o4w_A Lysozyme; protein folding, protein stability, protein engineering, hydrolase; 1.90A {Enterobacteria phage T4} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
d1swya_ 164 d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId 2e-08
d1xjua_ 158 d.2.1.3 (A:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10 5e-08
d1k28a3 216 d.2.1.3 (A:130-345) Tail-associated lysozyme gp5, catal 2e-07
>d1swya_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]} Length = 164 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Lysozyme-like
superfamily: Lysozyme-like
family: Phage lysozyme
domain: Phage T4 lysozyme
species: Bacteriophage T4 [TaxId: 10665]
 Score = 51.3 bits (122), Expect = 2e-08
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 11 LIEITKRYEGLKLTAYRDPGGTWTIGYGH 39
          + E+ +  EGL+L  Y+D  G +TIG GH
Sbjct: 3  IFEMLRIDEGLRLKIYKDTEGYYTIGIGH 31


>d1xjua_ d.2.1.3 (A:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]} Length = 158 Back     information, alignment and structure
>d1k28a3 d.2.1.3 (A:130-345) Tail-associated lysozyme gp5, catalytic domain {Bacteriophage T4 [TaxId: 10665]} Length = 216 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
d1xjua_ 158 Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]} 99.61
d1swya_ 164 Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]} 99.33
d1k28a3 216 Tail-associated lysozyme gp5, catalytic domain {Bacteri 99.21
>d1xjua_ d.2.1.3 (A:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Lysozyme-like
superfamily: Lysozyme-like
family: Phage lysozyme
domain: Endolysin Lyz
species: Bacteriophage P1 [TaxId: 10678]
Probab=99.61  E-value=1.2e-17  Score=103.70  Aligned_cols=36  Identities=31%  Similarity=0.530  Sum_probs=34.8

Q ss_pred             HHHHHHHHHHHHHCCCCCCCEECCCCCEEEECCCCC
Q ss_conf             343999999997528512430378997066202666
Q gi|254781057|r    6 KILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSG   41 (43)
Q Consensus         6 kis~a~i~lIk~~EG~r~~aY~d~~G~wTIGyGHTg   41 (43)
                      |+|+++|+|||.|||+|++||+||+|+||||||||-
T Consensus         1 k~s~~gi~lIk~~EG~~~~~Y~D~~G~~TIGyG~t~   36 (158)
T d1xjua_           1 RTNQAGLELIGNAEGCRRDPYMCPAGVWTDGIGNTH   36 (158)
T ss_dssp             CCCHHHHHHHCCHHHHHHCGGGSCGGGCCTTCCC--
T ss_pred             CCCHHHHHHHHHHHCCEEEEEECCCCCEEECCCCEE
T ss_conf             979899999998518820568889998057247032



>d1swya_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1k28a3 d.2.1.3 (A:130-345) Tail-associated lysozyme gp5, catalytic domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 43 hypothetical protein CLIBASIA_04795 [Candidatus Li
3eml_A_223-30482 (A:223-304) Human adenosine A2A receptor/T4 lysozy 1e-08
1xjt_A_1-118_160-191150 (A:1-118,A:160-191) Lysozyme; open conformation, h 5e-08
2rh1_A_238-31881 (A:238-318) Beta-2-adrenergic receptor/T4-lysozyme 6e-08
1xju_A_ 163 (A:) Lysozyme; secreted inactive conformation, hyd 2e-07
1wth_A_167-354 188 (A:167-354) Protein GP5, tail-associated lysozyme; 2e-07
2anv_A_ 146 (A:) Lysozyme; direct methods, lanthinide binding 6e-07
3hde_A_ 165 (A:) Lysozyme; antimicrobial, bacteriolytic enzyme 3e-06
1swy_A_ 164 (A:) Lysozyme; RB+ binding sites, AB initio direct 3e-06
2o4w_A_ 171 (A:) Lysozyme; protein folding, protein stability, 3e-05
2qb0_B_94-16168 (B:94-161) Telsam domain - lysozyme chimera; helic 1e-04
>3eml_A (A:223-304) Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens}Length = 82 Back     alignment and structure
 Score = 53.0 bits (127), Expect = 1e-08
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 11 LIEITKRYEGLKLTAYRDPGGTWTIGYGH 39
          + E+ +  EGL+L  Y+D  G +TIG GH
Sbjct: 3  IFEMLRIDEGLRLKIYKDTEGYYTIGIGH 31


>1xjt_A (A:1-118,A:160-191) Lysozyme; open conformation, hydrolase; HET: CIT; 1.75A {Enterobacteria phage P1}Length = 150 Back     alignment and structure
>2rh1_A (A:238-318) Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3d4s_A*Length = 81 Back     alignment and structure
>1xju_A (A:) Lysozyme; secreted inactive conformation, hydrolase; 1.07A {Enterobacteria phage P1}Length = 163 Back     alignment and structure
>1wth_A (A:167-354) Protein GP5, tail-associated lysozyme; triple-stranded beta-helix, OB fold, pseudohexamer, T4 tail lysozyme, GP5-GP27; 2.80A {Enterobacteria phage T4} PDB: 2z6b_A 1k28_A 1pdl_ALength = 188 Back     alignment and structure
>2anv_A (A:) Lysozyme; direct methods, lanthinide binding sites, hydrolase; 1.04A {Enterobacteria phage P22} PDB: 2anx_ALength = 146 Back     alignment and structure
>3hde_A (A:) Lysozyme; antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase, late protein; 1.95A {Enterobacteria phage P21}Length = 165 Back     alignment and structure
>1swy_A (A:) Lysozyme; RB+ binding sites, AB initio direct methods, hydrolase; 1.06A {Enterobacteria phage T4}Length = 164 Back     alignment and structure
>2o4w_A (A:) Lysozyme; protein folding, protein stability, protein engineering, hydrolase; 1.90A {Enterobacteria phage T4}Length = 171 Back     alignment and structure
>2qb0_B (B:94-161) Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli}Length = 68 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target43 hypothetical protein CLIBASIA_04795 [Candidatus Liberib
1xjt_A_1-118_160-191150 Lysozyme; open conformation, hydrolase; HET: CIT; 99.57
2anv_A_ 146 Lysozyme; direct methods, lanthinide binding sites 99.57
3eml_A_223-30482 Human adenosine A2A receptor/T4 lysozyme chimera; 99.54
2rh1_A_238-31881 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.53
1xju_A_ 163 Lysozyme; secreted inactive conformation, hydrolas 99.5
1wth_A_167-354 188 Protein GP5, tail-associated lysozyme; triple-stra 99.41
3hde_A_ 165 Lysozyme; antimicrobial, bacteriolytic enzyme, gly 99.4
1swy_A_ 164 Lysozyme; RB+ binding sites, AB initio direct meth 99.31
2qb0_B_94-16168 Telsam domain - lysozyme chimera; helical polymer, 98.64
2o4w_A_ 171 Lysozyme; protein folding, protein stability, prot 98.45
>1xjt_A (A:1-118,A:160-191) Lysozyme; open conformation, hydrolase; HET: CIT; 1.75A {Enterobacteria phage P1} Back     alignment and structure
Probab=99.57  E-value=1e-15  Score=96.31  Aligned_cols=40  Identities=30%  Similarity=0.549  Sum_probs=37.7

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCCEECCCCCEEEECCCCCC
Q ss_conf             5303439999999975285124303789970662026666
Q gi|254781057|r    3 GSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGS   42 (43)
Q Consensus         3 g~~kis~a~i~lIk~~EG~r~~aY~d~~G~wTIGyGHTg~   42 (43)
                      +.+++|+++++||+.|||++++||.|+.|+||||||||..
T Consensus        26 ~~~~~S~~~i~lIk~~EG~~~~~Y~D~~Gv~TIGyGhT~~   65 (150)
T 1xjt_A           26 GNVRTNQAGLELIGNAEGCRRDPYXCPAGVWTDGIGNTHG   65 (150)
T ss_dssp             TCCCCCHHHHHHHHHHHCCEEEEEECSSCCEEEETTBCSS
T ss_pred             CCCCCCHHHHHHHHHHHCCEEEEEECCCCCCEEEECCCCC
T ss_conf             7562389999999997488305677899996673062179



>2anv_A (A:) Lysozyme; direct methods, lanthinide binding sites, hydrolase; 1.04A {Enterobacteria phage P22} PDB: 2anx_A Back     alignment and structure
>3eml_A (A:223-304) Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} Back     alignment and structure
>2rh1_A (A:238-318) Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3d4s_A* Back     alignment and structure
>1xju_A (A:) Lysozyme; secreted inactive conformation, hydrolase; 1.07A {Enterobacteria phage P1} Back     alignment and structure
>1wth_A (A:167-354) Protein GP5, tail-associated lysozyme; triple-stranded beta-helix, OB fold, pseudohexamer, T4 tail lysozyme, GP5-GP27; 2.80A {Enterobacteria phage T4} PDB: 2z6b_A 1k28_A 1pdl_A Back     alignment and structure
>3hde_A (A:) Lysozyme; antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase, late protein; 1.95A {Enterobacteria phage P21} Back     alignment and structure
>1swy_A (A:) Lysozyme; RB+ binding sites, AB initio direct methods, hydrolase; 1.06A {Enterobacteria phage T4} Back     alignment and structure
>2qb0_B (B:94-161) Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli} Back     alignment and structure
>2o4w_A (A:) Lysozyme; protein folding, protein stability, protein engineering, hydrolase; 1.90A {Enterobacteria phage T4} Back     alignment and structure