254781056

254781056

phage-related lysozyme

GeneID in NCBI database:8210079Locus tag:CLIBASIA_04790
Protein GI in NCBI database:254781056Protein Accession:YP_003065469.1
Gene range:+(1061333, 1061848)Protein Length:171aa
Gene description:phage-related lysozyme
COG prediction:[R] Phage-related lysozyme (muraminidase)
KEGG prediction:phage-related lysozyme; K01185 lysozyme [EC:3.2.1.17]
SEED prediction:prophage LambdaMc01, lysozyme( EC:3.2.1.17 )
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
cHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccEccccccccccEEEEEccccccccccccEccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHEEEEEEEccccccccHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcc
MCIINRIISFVKRMigmngddkhnkipvPNALIKMLKEFEGLRLTAYrdigggawtigyghtgsdvtegmtITEKEAEDFLLKDASKSLNLLLesspalkstseNRLVAVADFVFNlgignynkstfkQRVDAQDWEKAAEECKKWTKaggkvlpglvKRRDAEVKLLLES
MCIINRIISFVKRmigmngddkhnkIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSpalkstsenRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKwtkaggkvlpglvkrrdaevkllles
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
*CIINRIISFVKRMIGMNGDD****IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target171 phage-related lysozyme [Candidatus Liberibacter asiatic
254781058102 phage-related lysozyme [Candidatus Liberibacter as 1e-39
25478105743 hypothetical protein CLIBASIA_04795 [Candidatus Li 3e-10
>gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 102 Back     alignment
 Score =  154 bits (388), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 82/100 (82%)

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129
           MTIT KEAED LL D    L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ
Sbjct: 1   MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60

Query: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           RVDAQDWEKAAEECKKWTKAGG+ L G+  RR     +LL
Sbjct: 61  RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100

>gi|254781057|ref|YP_003065470.1| hypothetical protein CLIBASIA_04795 [Candidatus Liberibacter asiaticus str. psy62] Length = 43 Back     alignment
 Score = 56.2 bits (134), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 6/48 (12%)

Query: 17 MNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS 64
          MNG  K     + NALI++ K +EGL+LTAYRD  GG WTIGYGH+GS
Sbjct: 1  MNGSSK-----ILNALIEITKRYEGLKLTAYRDP-GGTWTIGYGHSGS 42

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target171 phage-related lysozyme [Candidatus Liberibacter asiatic
315121922149 phage-related lysozyme [Candidatus Liberibacter solanac 1 4e-37
254781058102 phage-related lysozyme [Candidatus Liberibacter asiatic 1 5e-36
315122498146 phage-related lysozyme [Candidatus Liberibacter solanac 1 3e-35
315122565133 phage-related lysozyme [Candidatus Liberibacter solanac 1 8e-32
152982881174 phage-related lysozyme [Janthinobacterium sp. Marseille 1 2e-27
161525479154 glycoside hydrolase family protein [Burkholderia multiv 1 3e-27
17545602153 lysozyme (endolysin) protein [Ralstonia solanacearum GM 1 8e-27
152983117171 phage-related lysozyme [Janthinobacterium sp. Marseille 1 2e-26
53803105152 prophage LambdaMc01, lysozyme [Methylococcus capsulatus 1 2e-26
300697169153 lysozyme (endolysin) protein [Ralstonia solanacearum CF 1 3e-26
>gi|315121922|ref|YP_004062411.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 149 Back     alignment and organism information
 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/144 (55%), Positives = 98/144 (68%), Gaps = 1/144 (0%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           +P+ LI ++K FEGLRL AYR    G WTIGYGHTG+DV E + ITEK+A D L  D SK
Sbjct: 1   MPHLLIDLVKGFEGLRLKAYR-CSAGIWTIGYGHTGNDVFENLAITEKQANDLLKWDVSK 59

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            L+ +   SP L +  ENR+ A+ DFVFNLGIG Y  ST ++RVD +DW  A+ E  KW 
Sbjct: 60  CLSQVFTVSPILINAGENRISAIGDFVFNLGIGRYRNSTLRKRVDREDWINASHEICKWV 119

Query: 148 KAGGKVLPGLVKRRDAEVKLLLES 171
            AGGK L GLV RR+ E  LLL+S
Sbjct: 120 FAGGKKLKGLVIRREIEADLLLKS 143


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 102 Back     alignment and organism information
>gi|315122498|ref|YP_004062987.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 146 Back     alignment and organism information
>gi|315122565|ref|YP_004063054.1| phage-related lysozyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 133 Back     alignment and organism information
>gi|152982881|ref|YP_001354478.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 174 Back     alignment and organism information
>gi|161525479|ref|YP_001580491.1| glycoside hydrolase family protein [Burkholderia multivorans ATCC 17616] Length = 154 Back     alignment and organism information
>gi|17545602|ref|NP_519004.1| lysozyme (endolysin) protein [Ralstonia solanacearum GMI1000] Length = 153 Back     alignment and organism information
>gi|152983117|ref|YP_001354418.1| phage-related lysozyme [Janthinobacterium sp. Marseille] Length = 171 Back     alignment and organism information
>gi|53803105|ref|YP_115084.1| prophage LambdaMc01, lysozyme [Methylococcus capsulatus str. Bath] Length = 152 Back     alignment and organism information
>gi|300697169|ref|YP_003747830.1| lysozyme (endolysin) protein [Ralstonia solanacearum CFBP2957] Length = 153 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target171 phage-related lysozyme [Candidatus Liberibacter asiatic
COG3772152 COG3772, COG3772, Phage-related lysozyme (muraminidase) 3e-30
pfam00959108 pfam00959, Phage_lysozyme, Phage lysozyme 4e-16
PHA02596 576 PHA02596, 5, baseplate hub subunit and tail lysozyme; P 7e-07
cd00735164 cd00735, bacteriophage_T4-like_lysozyme, Bacteriophage 1e-05
cd00737133 cd00737, endolysin_autolysin, Endolysins and autolysins 5e-33
>gnl|CDD|33567 COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>gnl|CDD|144526 pfam00959, Phage_lysozyme, Phage lysozyme Back     alignment and domain information
>gnl|CDD|177423 PHA02596, 5, baseplate hub subunit and tail lysozyme; Provisional Back     alignment and domain information
>gnl|CDD|29559 cd00735, bacteriophage_T4-like_lysozyme, Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls Back     alignment and domain information
>gnl|CDD|29561 cd00737, endolysin_autolysin, Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 171 phage-related lysozyme [Candidatus Liberibacter asiatic
cd00737133 endolysin_autolysin Endolysins and autolysins are found 100.0
COG3772152 Phage-related lysozyme (muraminidase) [General function 100.0
cd00735164 bacteriophage_T4-like_lysozyme Bacteriophage T4-like ly 99.93
pfam00959108 Phage_lysozyme Phage lysozyme. This family includes lam 100.0
cd00442105 lysozyme_like lysozyme_like domain. This contains sever 95.89
>cd00737 endolysin_autolysin Endolysins and autolysins are found in viruses and bacteria, respectively Back     alignment and domain information
>COG3772 Phage-related lysozyme (muraminidase) [General function prediction only] Back     alignment and domain information
>cd00735 bacteriophage_T4-like_lysozyme Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls Back     alignment and domain information
>pfam00959 Phage_lysozyme Phage lysozyme Back     alignment and domain information
>cd00442 lysozyme_like lysozyme_like domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target171 phage-related lysozyme [Candidatus Liberibacter asiatic
3hde_A165 Crystal Structure Of Full-Length Endolysin R21 From 5e-30
3hdf_A140 Crystal Structure Of Truncated Endolysin R21 From P 1e-29
2anv_A146 Crystal Structure Of P22 Lysozyme Mutant L86m Lengt 3e-27
1xju_A163 Crystal Structure Of Secreted Inactive Form Of P1 P 3e-21
3oe0_A499 Crystal Structure Of The Cxcr4 Chemokine Receptor I 8e-09
2z6b_A 584 Crystal Structure Analysis Of (Gp27-Gp5)3 Conjugate 9e-09
1wth_A 584 Crystal Structure Of Gp5-S351l Mutant And Gp27 Comp 9e-09
1pdl_A 575 Fitting Of Gp5 In The Cryoem Reconstruction Of The 9e-09
1k28_A 584 The Structure Of The Bacteriophage T4 Cell-Puncturi 9e-09
1p37_A164 T4 Lysozyme Core Repacking Back-Revertant L102mCORE 3e-08
1pqi_A164 T4 Lysozyme Core Repacking Mutant I118lCORE7TA Leng 4e-08
1p3n_A164 Core Redesign Back-Revertant I103vCORE10 Length = 1 5e-08
1pqk_A164 Repacking Of The Core Of T4 Lysozyme By Automated D 5e-08
3oe6_A 508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 6e-08
176l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 6e-08
3odu_A502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 6e-08
239l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 6e-08
1pqd_A164 T4 Lysozyme Core Repacking Mutant Core10TA Length = 7e-08
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 7e-08
235l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 8e-08
1l70_A164 Multiple Stabilizing Alanine Replacements Within Al 8e-08
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 9e-08
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 9e-08
1dya_A164 Determination Of Alpha-Helix Propensity Within The 9e-08
1l55_A164 Analysis Of The Interaction Between Charged Side Ch 9e-08
1l21_A164 Contributions Of Left-Handed Helical Residues To Th 1e-07
3eml_A 488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 1e-07
189l_A164 Enhancement Of Protein Stability By The Combination 1e-07
3d4s_A490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 1e-07
1kni_A164 Stabilizing Disulfide Bridge Mutant Of T4 Lysozyme 1e-07
1l22_A164 Contributions Of Left-Handed Helical Residues To Th 1e-07
1b6i_A164 T4 Lysozyme Mutant With Cys 54 Replaced By Thr, Cys 1e-07
1cv5_A164 T4 Lysozyme Mutant L133m Length = 164 1e-07
1dyg_A164 Determination Of Alpha-Helix Propensity Within The 1e-07
213l_A165 Protein Structure Plasticity Exemplified By Inserti 1e-07
1p2r_A164 T4 Lysozyme Core Repacking Mutant I78vTA Length = 1 1e-07
232l_A164 T4 Lysozyme Mutant M120k Length = 164 1e-07
3pds_A458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 1e-07
1p64_A164 T4 Lysozyme Core Repacking Mutant L133fTA Length = 2e-07
230l_A164 T4 Lysozyme Mutant M6l Length = 164 2e-07
1cu3_A164 T4 Lysozyme Mutant V87m Length = 164 2e-07
2a4t_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (V131 2e-07
1jqu_A164 Are Carboxy Terminii Of Helices Coded By The Local 2e-07
1l33_A164 Contributions Of Left-Handed Helical Residues To Th 2e-07
1jtm_A178 Alternative Structures Of A Sequence Extended T4 Ly 2e-07
160l_A164 Control Of Enzyme Activity By An Engineered Disulfi 2e-07
1p46_A164 T4 Lysozyme Core Repacking Mutant M106iTA Length = 2e-07
1g0q_A164 Crystal Structure Of T4 Lysozyme Mutant V149i Lengt 2e-07
1pqm_A164 T4 Lysozyme Core Repacking Mutant V149iT152VTA Leng 2e-07
1tla_A164 Hydrophobic Core Repacking And Aromatic-Aromatic In 2e-07
163l_A164 Control Of Enzyme Activity By An Engineered Disulfi 2e-07
1kw7_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 2e-07
1d3f_A164 N-Terminal Domain Core Methionine Mutation Length = 2e-07
3cdr_A164 R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K 2e-07
1l71_A164 Multiple Stabilizing Alanine Replacements Within Al 2e-07
1cv1_A164 T4 Lysozyme Mutant V111m Length = 164 2e-07
259l_A164 An Adaptable Metal-Binding Site Engineered Into T4 2e-07
233l_A164 T4 Lysozyme Mutant M120l Length = 164 2e-07
1p2l_A164 T4 Lysozyme Core Repacking Mutant V87iTA Length = 1 2e-07
123l_A164 The Energetic Cost And The Structural Consequences 2e-07
119l_A164 The Energetic Cost And The Structural Consequences 2e-07
120l_A164 The Energetic Cost And The Structural Consequences 2e-07
206l_A164 Phage T4 Lysozyme Length = 164 2e-07
1cup_A164 Methionine Core Mutant Of T4 Lysozyme Length = 164 2e-07
221l_A164 The Energetic Cost And The Structural Consequences 2e-07
1pqj_A164 T4 Lysozyme Core Repacking Mutant A111vCORE10TA Len 2e-07
1p6y_A164 T4 Lysozyme Core Repacking Mutant M120yTA Length = 2e-07
128l_A164 The Energetic Cost And The Structural Consequences 2e-07
1dye_A164 Determination Of Alpha-Helix Propensity Within The 2e-07
224l_A164 The Energetic Cost And The Structural Consequences 2e-07
1l61_A164 Analysis Of The Interaction Between Charged Side Ch 2e-07
1l64_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 2e-07
2o79_A170 T4 Lysozyme With C-Terminal Extension Length = 170 2e-07
112l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-07
2q9d_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 2e-07
1zyt_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (A82r 2e-07
1qtb_A162 The Introduction Of Strain And Its Effects On The S 2e-07
1l95_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-07
1g1v_A164 T4 Lysozyme Mutant C54tC97AI58T Length = 164 2e-07
1l86_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-07
1c6p_A164 T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 AT 2e-07
1g0l_A164 Crystal Structure Of T4 Lysozyme Mutant T152v Lengt 2e-07
170l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 2e-07
108l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-07
110l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-07
114l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 2e-07
1l87_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 2e-07
1g06_A164 Crystal Structure Of T4 Lysozyme Mutant V149s Lengt 2e-07
130l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-07
1g0j_A164 Crystal Structure Of T4 Lysozyme Mutant T152s Lengt 2e-07
1lwg_A164 Multiple Methionine Substitutions Are Tolerated In 3e-07
111l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
115l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
1l23_A164 Enhanced Protein Thermostability From Site-Directed 3e-07
126l_A164 The Energetic Cost And The Structural Consequences 3e-07
1g0m_A164 Crystal Structure Of T4 Lysozyme Mutant T152i Lengt 3e-07
1qug_A162 E108v Mutant Of T4 Lysozyme Length = 162 3e-07
1llh_A164 Are Carboxy Terminii Of Helices Coded By The Local 3e-07
238l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
137l_A164 Structural Basis Of Amino Acid Alpha Helix Propensi 3e-07
1cu2_A164 T4 Lysozyme Mutant L84m Length = 164 3e-07
1p36_A164 T4 Lyoszyme Core Repacking Mutant I100vTA Length = 3e-07
107l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
1l66_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 3e-07
171l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 3e-07
234l_A164 T4 Lysozyme Mutant M106l Length = 164 3e-07
166l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-07
1g0p_A164 Crystal Structure Of T4 Lysozyme Mutant V149g Lengt 3e-07
2l78_A164 Design And Structural Analysis Of Alternative Hydro 3e-07
122l_A164 The Energetic Cost And The Structural Consequences 3e-07
3g3w_A164 Crystal Structure Of Spin Labeled T4 Lysozyme (T151 3e-07
172l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 3e-07
217l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
109l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
1cu5_A164 T4 Lysozyme Mutant L91m Length = 164 3e-07
1l88_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-07
1c60_A164 T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF 3e-07
149l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 3e-07
1epy_A164 T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = 3e-07
129l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 3e-07
1l39_A164 Contributions Of Engineered Surface Salt Bridges To 3e-07
247l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1d2y_A164 N-Terminal Domain Core Methionine Mutation Length = 3e-07
1l67_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 3e-07
1p56_A176 Duplication-Extension Of Helix A Of T4 Lysozyme Len 3e-07
1l68_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 3e-07
237l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1cv6_A164 T4 Lysozyme Mutant V149m Length = 164 3e-07
242l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1l65_A164 Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arr 3e-07
1l24_A164 Enhanced Protein Thermostability From Site-Directed 3e-07
1g0g_A164 Crystal Structure Of T4 Lysozyme Mutant T152a Lengt 3e-07
165l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-07
1pqo_A164 T4 Lysozyme Core Repacking Mutant L118iTA Length = 3e-07
1cv4_A164 T4 Lysozyme Mutant L118m Length = 164 3e-07
236l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1d3j_A164 N-Terminal Domain Core Methionine Mutation Length = 3e-07
244l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1l47_A164 Cumulative Site-Directed Charge-Change Replacements 3e-07
2hul_A164 Crystal Structure Of T4 Lysozyme S44c Synthetic Dim 3e-07
155l_A164 Control Of Enzyme Activity By An Engineered Disulfi 3e-07
113l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 3e-07
243l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-07
1g07_A164 Crystal Structure Of T4 Lysozyme Mutant V149c Lengt 3e-07
1g0k_A164 Crystal Structure Of T4 Lysozyme Mutant T152c Lengt 3e-07
1l94_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-07
2igc_A164 Structure Of Spin Labeled T4 Lysozyme Mutant T115r1 3e-07
1l41_A164 Contributions Of Engineered Surface Salt Bridges To 3e-07
201l_A166 How Amino-Acid Insertions Are Allowed In An Alpha-H 3e-07
1l92_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-07
212l_A168 Protein Structure Plasticity Exemplified By Inserti 3e-07
1p7s_A164 T4 Lysozyme Core Repacking Mutant V103iTA Length = 3e-07
1l97_A164 Structure Of A Hinge-Bending Bacteriophage T4 Lysoz 3e-07
102l_A165 How Amino-Acid Insertions Are Allowed In An Alpha-H 3e-07
1l93_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 3e-07
1lyf_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 3e-07
2nth_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 4e-07
211l_A165 Protein Structure Plasticity Exemplified By Inserti 4e-07
161l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-07
1l16_A164 Structural Analysis Of The Temperature-Sensitive Mu 4e-07
3c7w_A164 Contributions Of All 20 Amino Acids At Site 96 To T 4e-07
1l17_A164 Hydrophobic Stabilization In T4 Lysozyme Determined 4e-07
1l45_A164 Cumulative Site-Directed Charge-Change Replacements 4e-07
1l15_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l19_A164 Enhanced Protein Thermostability From Designed Muta 4e-07
1lyd_A164 Crystal Structure Of T4-Lysozyme Generated From Syn 4e-07
1l09_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
152l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 4e-07
2q9e_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant S44r1 4e-07
2huk_A164 Crystal Structure Of T4 Lysozyme V131c Synthetic Di 4e-07
3hwl_A164 Crystal Structure Of T4 Lysozyme With The Unnatural 4e-07
1dyf_A164 Determination Of Alpha-Helix Propensity Within The 4e-07
1l14_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l52_A164 Structural And Thermodynamic Analysis Of The Packin 4e-07
1l10_A164 Structural Studies Of Mutants Of The Lysozyme Of Ba 4e-07
1l04_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1cuq_A164 T4 Lysozyme Mutant V103m Length = 164 4e-07
1dyc_A164 Determination Of Alpha-Helix Propensity Within The 4e-07
1i6s_A164 T4 Lysozyme Mutant C54tC97AN101A Length = 164 4e-07
3k2r_A164 Crystal Structure Of Spin Labeled T4 Lysozyme Mutan 4e-07
1t6h_A164 Crystal Structure T4 Lysozyme Incorporating An Unna 4e-07
216l_A164 Structural Basis Of Alpha-Helix Propensity At Two S 4e-07
1l91_A164 Similar Hydrophobic Replacements Of Leu 99 And Phe 4e-07
1l11_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1dyb_A164 Determination Of Alpha-Helix Propensity Within The 4e-07
1l12_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l07_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
2qb0_B241 Structure Of The 2tel Crystallization Module Fused 4e-07
1l0k_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 4e-07
159l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-07
1l57_A164 Analysis Of The Interaction Between Charged Side Ch 4e-07
3c80_A164 T4 Lysozyme Mutant R96y At Room Temperature Length 4e-07
1l08_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1cvk_A164 T4 Lysozyme Mutant L118a Length = 164 4e-07
1qsq_A164 Cavity Creating Mutation Length = 164 4e-07
162l_A164 Control Of Enzyme Activity By An Engineered Disulfi 4e-07
138l_A164 Rapid Crystallization Of T4 Lysozyme By Intermolecu 4e-07
1l60_A164 Analysis Of The Interaction Between Charged Side Ch 4e-07
2hum_A164 Crystal Structure Of T4 Lysozyme D72c Synthetic Dim 4e-07
3fa0_A162 Evaulaution At Atomic Resolution Of The Role Of Str 4e-07
1kw5_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 4e-07
1l06_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l20_A164 Enhanced Protein Thermostability From Designed Muta 4e-07
1l46_A164 Cumulative Site-Directed Charge-Change Replacements 4e-07
1l79_A164 Design And Structural Analysis Of Alternative Hydro 4e-07
3c81_A164 Mutant K85a Of T4 Lysozyme In Wildtype Background A 4e-07
1cu0_A164 T4 Lysozyme Mutant I78m Length = 164 4e-07
1l18_A164 Hydrophobic Stabilization In T4 Lysozyme Determined 4e-07
229l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 4e-07
1l56_A164 Analysis Of The Interaction Between Charged Side Ch 4e-07
1l02_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 4e-07
1l98_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 4e-07
1l42_A164 Cumulative Site-Directed Charge-Change Replacements 4e-07
127l_A164 The Energetic Cost And The Structural Consequences 4e-07
1cv3_A164 T4 Lysozyme Mutant L121m Length = 164 5e-07
1ky1_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 5e-07
1l01_A164 Structural Studies Of Mutants Of The Lysozyme Of Ba 5e-07
1cx7_A164 T4 Lysozyme Methionine Core Mutant Length = 164 5e-07
1ky0_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 5e-07
1ctw_A164 T4 Lysozyme Mutant I78a Length = 164 5e-07
1l38_A164 Contributions Of Engineered Surface Salt Bridges To 5e-07
1l34_A164 High-Resolution Structure Of The Temperature-Sensit 5e-07
1l59_A164 Analysis Of The Interaction Between Charged Side Ch 5e-07
103l_A167 How Amino-Acid Insertions Are Allowed In An Alpha-H 5e-07
1l53_A164 Structural And Thermodynamic Analysis Of The Packin 5e-07
1l99_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 5e-07
1l62_A164 Analysis Of The Interaction Between Charged Side Ch 5e-07
1l03_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 5e-07
1l76_A164 Tolerance Of T4 Lysozyme To Proline Substitutions W 5e-07
1l13_A164 Contributions Of Hydrogen Bonds Of Thr 157 To The T 5e-07
104l_A166 How Amino-Acid Insertions Are Allowed In An Alpha-H 5e-07
1l35_A164 Structure Of A Thermostable Disulfide-Bridge Mutant 5e-07
1l29_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 5e-07
1l77_A164 Design And Structural Analysis Of Alternative Hydro 5e-07
164l_A164 Control Of Enzyme Activity By An Engineered Disulfi 5e-07
241l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 5e-07
3c83_A164 Bacteriophage T4 Lysozyme Mutant D89a In Wildtype B 5e-07
156l_A164 Control Of Enzyme Activity By An Engineered Disulfi 5e-07
231l_A164 T4 Lysozyme Mutant M106k Length = 164 5e-07
1l58_A164 Analysis Of The Interaction Between Charged Side Ch 5e-07
1dyd_A164 Determination Of Alpha-Helix Propensity Within The 5e-07
139l_A164 Rapid Crystallization Of T4 Lysozyme By Intermolecu 6e-07
174l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 6e-07
1l37_A164 Contributions Of Engineered Surface Salt Bridges To 6e-07
3c82_A164 Bacteriophage Lysozyme T4 Lysozyme Mutant K85aR96H 6e-07
3cdv_A164 Contributions Of All 20 Amino Acids At Site 96 To T 6e-07
143l_A164 Role Of Backbone Flexibility In The Accommodation O 6e-07
118l_A164 The Energetic Cost And The Structural Consequences 6e-07
1l00_A164 Perturbation Of Trp 138 In T4 Lysozyme By Mutations 6e-07
215l_A165 Protein Structure Plasticity Exemplified By Inserti 6e-07
158l_A164 Control Of Enzyme Activity By An Engineered Disulfi 6e-07
1ks3_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 6e-07
196l_A164 Thermodynamic And Structural Compensation In "size- 6e-07
125l_A164 The Energetic Cost And The Structural Consequences 6e-07
1t8g_A164 Crystal Structure Of Phage T4 Lysozyme Mutant L32aL 6e-07
250l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 6e-07
3f9l_A164 Evaulaution At Atomic Resolution Of The Role Of Str 7e-07
2ou9_A164 Structure Of Spin-Labeled T4 Lysozyme Mutant T115r1 7e-07
1l27_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 7e-07
1l32_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 7e-07
1qtz_A164 D20c Mutant Of T4 Lysozyme Length = 164 7e-07
3c7z_A164 T4 Lysozyme Mutant D89aR96H AT ROOM TEMPERATURE Len 7e-07
1c6c_A164 T4 Lysozyme Mutant C54tC97AL99A IN THE PRESENCE OF 7e-07
1qs9_A162 The Introduction Of Strain And Its Effects On The S 7e-07
197l_A164 Thermodynamic And Structural Compensation In "size- 7e-07
1l30_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 7e-07
1qth_A164 The Introduction Of Strain And Its Effects On The S 7e-07
1quo_A162 L99aE108V MUTANT OF T4 LYSOZYME Length = 162 7e-07
150l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 7e-07
1l28_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 7e-07
1g1w_A164 T4 Lysozyme Mutant C54tC97AQ105M Length = 164 7e-07
218l_A165 Protein Structure Plasticity Exemplified By Inserti 7e-07
205l_A167 How Amino-Acid Insertions Are Allowed In An Alpha-H 7e-07
1l51_A164 Structural And Thermodynamic Analysis Of The Packin 7e-07
1quh_A162 L99gE108V MUTANT OF T4 LYSOZYME Length = 162 7e-07
1lyi_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 7e-07
2b6t_A162 T4 Lysozyme Mutant L99a At 200 Mpa Length = 162 7e-07
1qsb_A162 The Introduction Of Strain And Its Effects On The S 7e-07
1c6l_A164 T4 Lysozyme Mutant C54tC97AL99AF153A IN THE PRESENC 7e-07
1c63_A164 T4 Lysozyme Mutant C54tC97AL121A IN THE PRESENCE OF 8e-07
1l26_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-07
1cu6_A164 T4 Lysozyme Mutant L91a Length = 164 8e-07
1l72_A164 Multiple Stabilizing Alanine Replacements Within Al 8e-07
1l25_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-07
1l81_A164 Design And Structural Analysis Of Alternative Hydro 8e-07
1d9w_A164 Bacteriophage T4 Lysozyme Mutant Length = 164 8e-07
1qud_A162 L99g Mutant Of T4 Lysozyme Length = 162 8e-07
1d3m_A164 Methionine Core Mutation Length = 164 8e-07
1l31_A164 Replacements Of Pro86 In Phage T4 Lysozyme Extend A 8e-07
3c8s_A164 Contributions Of All 20 Amino Acids At Site 96 To T 8e-07
3fad_A164 Evaulaution At Atomic Resolution Of The Role Of Str 9e-07
1l44_A164 Cumulative Site-Directed Charge-Change Replacements 9e-07
1l82_A164 Design And Structural Analysis Of Alternative Hydro 9e-07
3fi5_A164 Crystal Structure Of T4 Lysozyme Mutant R96w Length 9e-07
167l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 9e-07
1l80_A164 Design And Structural Analysis Of Alternative Hydro 9e-07
1l48_A164 Structural And Thermodynamic Analysis Of The Packin 9e-07
175l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 9e-07
1lyg_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 9e-07
1l49_A164 Structural And Thermodynamic Analysis Of The Packin 9e-07
151l_A164 Conservation Of Solvent-Binding Sites In 10 Crystal 9e-07
245l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 1e-06
220l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 1e-06
3c8q_A164 Contribution Of All 20 Amino Acids At Site 96 To Th 1e-06
1c69_A164 T4 Lysozyme Mutant C54tC97AL133A IN THE PRESENCE OF 1e-06
1qs5_A162 The Introduction Of Strain And Its Effects On The S 1e-06
3cdt_A164 Contributions Of All 20 Amino Acids At Site 96 To T 1e-06
1l0j_A162 Methionine Core Mutant Of T4 Lysozyme Length = 162 1e-06
3cdo_A164 Bacteriophage T4 Lysozyme Mutant R96v In Wildtype B 1e-06
3cdq_A164 Contributions Of All 20 Amino Acids At Site 96 To T 1e-06
246l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 1e-06
2qar_C163 Structure Of The 2tel Crystallization Module Fused 1e-06
3jr6_A170 Sequential Reorganization Of Beta-Sheet Topology By 1e-06
1l50_A164 Structural And Thermodynamic Analysis Of The Packin 1e-06
177l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 1e-06
173l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 1e-06
144l_A164 Role Of Backbone Flexibility In The Accommodation O 1e-06
3c7y_A164 Mutant R96a Of T4 Lysozyme In Wildtype Background A 1e-06
3guj_A164 T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN 1e-06
190l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 1e-06
1lyh_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 1e-06
141l_A164 Role Of Backbone Flexibility In The Accommodation O 1e-06
1swy_A164 Use Of A Halide Binding Site To Bypass The 1000-Ato 1e-06
1cv0_A164 T4 Lysozyme Mutant F104m Length = 164 2e-06
131l_A164 Structures Of Randomly Generated Mutants Of T4 Lyso 2e-06
252l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 2e-06
1lyj_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 2e-06
1d2w_A164 N-Terminal Domain Core Methionine Mutation Length = 2e-06
223l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 2e-06
195l_A164 Thermodynamic And Structural Compensation In "size- 2e-06
146l_A164 Role Of Backbone Flexibility In The Accommodation O 2e-06
214l_A165 Protein Structure Plasticity Exemplified By Inserti 2e-06
1l54_A164 The Structural And Thermodynamic Consequences Of Bu 2e-06
140l_A164 Role Of Backbone Flexibility In The Accommodation O 2e-06
199l_A164 Thermodynamic And Structural Compensation In "size- 2e-06
147l_A164 Role Of Backbone Flexibility In The Accommodation O 2e-06
3l2x_A164 Crystal Structure Of Spin Labeled T4 Lysozyme Mutan 2e-06
3c8r_A164 Contributions Of All 20 Amino Acids At Site 96 To S 2e-06
1c66_A164 T4 Lysozyme Mutant C54tC97AL121AL133A IN THE PRESEN 2e-06
240l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 2e-06
3gui_A164 T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN 2e-06
1qt5_A164 D20e Mutant Structure Of T4 Lysozyme Length = 164 2e-06
255l_A164 Hydrolase Length = 164 2e-06
1qt8_A164 T26h Mutant Of T4 Lysozyme Length = 164 2e-06
1lye_A164 Dissection Of Helix Capping In T4 Lysozyme By Struc 2e-06
210l_A163 Protein Structure Plasticity Exemplified By Inserti 2e-06
254l_A164 Lysozyme Length = 164 2e-06
1qtc_A162 The Introduction Of Strain And Its Effects On The S 2e-06
249l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 3e-06
227l_A164 Generating Ligand Binding Sites In T4 Lysozyme Usin 3e-06
1qt7_A164 E11n Mutant Of T4 Lysozyme Length = 164 3e-06
142l_A164 Role Of Backbone Flexibility In The Accommodation O 3e-06
1qt3_A164 T26d Mutant Of T4 Lysozyme Length = 164 3e-06
1oyu_A175 Long-Distance Conformational Changes In A Protein E 3e-06
253l_A164 Lysozyme Length = 164 3e-06
1t8a_A175 Use Of Sequence Duplication To Engineer A Ligand-Tr 4e-06
248l_A164 The Response Of T4 Lysozyme To Large-To-Small Subst 4e-06
145l_A164 Role Of Backbone Flexibility In The Accommodation O 4e-06
198l_A164 Thermodynamic And Structural Compensation In "size- 5e-06
1lgu_A164 T4 Lysozyme Mutant L99aM102Q Length = 164 5e-06
1qt4_A164 T26q Mutant Of T4 Lysozyme Length = 164 5e-06
261l_A173 Structural Characterisation Of An Engineered Tandem 5e-06
3ht6_A164 2-Methylphenol In Complex With T4 Lysozyme L99aM102 6e-06
148l_E164 A Covalent Enzyme-Substrate Intermediate With Sacch 6e-06
2rbn_A162 N-Phenylglycinonitrile In Complex With T4 Lysozyme 6e-06
3huq_A162 Thieno[3,2-B]thiophene In Complex With T4 Lysozyme 7e-06
3dke_X164 Polar And Non-Polar Cavities In Phage T4 Lysozyme L 7e-06
1qtd_A162 The Introduction Of Strain And Its Effects On The S 9e-06
157l_A164 Control Of Enzyme Activity By An Engineered Disulfi 1e-05
3dn8_A164 Iodopentafluorobenzene Binding In The Hydrophobic C 1e-05
1ssy_A164 Crystal Structure Of Phage T4 Lysozyme Mutant G28aI 4e-05
209l_A167 Protein Structure Plasticity Exemplified By Inserti 2e-04
1ssw_A164 Crystal Structure Of Phage T4 Lysozyme Mutant Y24aY 2e-04
1d3n_A164 Methionine Core Mutation Length = 164 3e-04
1cx6_A164 T4 Lysozyme Substituted With Selenomethionine Lengt 0.001
1lwk_A164 Multiple Methionine Substitutions Are Tolerated In 0.002
1lpy_A164 Multiple Methionine Substitutions In T4 Lysozyme Le 0.004
1xjt_A191 Crystal Structure Of Active Form Of P1 Phage Endoly 2e-21
169l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 2e-05
168l_A164 Protein Flexibility And Adaptability Seen In 25 Cry 3e-05
1l74_A164 Multiple Stabilizing Alanine Replacements Within Al 3e-05
1l36_A164 Toward A Simplification Of The Protein Folding Prob 3e-05
192l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 4e-05
1l75_A164 Multiple Stabilizing Alanine Replacements Within Al 5e-05
1l73_A164 Multiple Stabilizing Alanine Replacements Within Al 5e-05
191l_A164 A Helix Initiation Signal In T4 Lysozyme Identified 1e-04
gi|262367957|pdb|3HDE|A Chain A, Crystal Structure Of Full-Length Endolysin R21 From Phage 21 Length = 165 Back     alignment and structure
 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 70/130 (53%), Gaps = 3/130 (2%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG+    Y+DI  G WT+ +GHTG D+  G T T+ E +  L KD +     +       
Sbjct: 35  EGVSYIPYKDI-VGVWTVCHGHTGKDIMLGKTYTKAECKALLNKDLATVARQINPYIK-- 91

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVK 159
               E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL+ 
Sbjct: 92  VDIPETMRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMT 151

Query: 160 RRDAEVKLLL 169
           RR+ E ++ L
Sbjct: 152 RREIEREICL 161


>gi|262367961|pdb|3HDF|A Chain A, Crystal Structure Of Truncated Endolysin R21 From Phage 21 Length = 140 Back     alignment and structure
>gi|90108744|pdb|2ANV|A Chain A, Crystal Structure Of P22 Lysozyme Mutant L86m Length = 146 Back     alignment and structure
>gi|60594001|pdb|1XJU|A Chain A, Crystal Structure Of Secreted Inactive Form Of P1 Phage Endolysin Lyz Length = 163 Back     alignment and structure
>gi|310689930|pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 Back     alignment and structure
>gi|183448228|pdb|2Z6B|A Chain A, Crystal Structure Analysis Of (Gp27-Gp5)3 Conjugated With Fe(Iii) Protoporphyrin Length = 584 Back     alignment and structure
>gi|62738309|pdb|1WTH|A Chain A, Crystal Structure Of Gp5-S351l Mutant And Gp27 Complex Length = 584 Back     alignment and structure
gi|34809729|pdb|1PDL|A Chain A, Fitting Of Gp5 In The Cryoem Reconstruction Of The Bacteriophage T4 Baseplate Length = 575 Back     alignment and structure
>gi|18655470|pdb|1K28|A Chain A, The Structure Of The Bacteriophage T4 Cell-Puncturing Device Length = 584 Back     alignment and structure
>gi|37927387|pdb|1P37|A Chain A, T4 Lysozyme Core Repacking Back-Revertant L102mCORE10 Length = 164 Back     alignment and structure
>gi|37927581|pdb|1PQI|A Chain A, T4 Lysozyme Core Repacking Mutant I118lCORE7TA Length = 164 Back     alignment and structure
>gi|37927389|pdb|1P3N|A Chain A, Core Redesign Back-Revertant I103vCORE10 Length = 164 Back     alignment and structure
>gi|37927585|pdb|1PQK|A Chain A, Repacking Of The Core Of T4 Lysozyme By Automated Design Length = 164 Back     alignment and structure
>gi|310689932|pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>gi|1065176|pdb|176L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|310689928|pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure
>gi|157834496|pdb|239L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|37927571|pdb|1PQD|A Chain A, T4 Lysozyme Core Repacking Mutant Core10TA Length = 164 Back     alignment and structure
>gi|310943018|pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>gi|157834492|pdb|235L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831726|pdb|1L70|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 Back     alignment and structure
>gi|319443693|pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>gi|159795485|pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein-Coupled Receptor Length = 500 Back     alignment and structure
>gi|157830899|pdb|1DYA|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831711|pdb|1L55|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831677|pdb|1L21|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|209447557|pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>gi|157829619|pdb|189L|A Chain A, Enhancement Of Protein Stability By The Combination Of Point Mutations In T4 Lysozyme Is Additive Length = 164 Back     alignment and structure
>gi|190613726|pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>gi|18158814|pdb|1KNI|A Chain A, Stabilizing Disulfide Bridge Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831678|pdb|1L22|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6980610|pdb|1B6I|A Chain A, T4 Lysozyme Mutant With Cys 54 Replaced By Thr, Cys 97 Replaced By Ala, Thr 21 Replaced By Cys And Lys 124 Replaced By Cys (C54t,C97a,T21c,K124c) Length = 164 Back     alignment and structure
>gi|6729790|pdb|1CV5|A Chain A, T4 Lysozyme Mutant L133m Length = 164 Back     alignment and structure
>gi|157830905|pdb|1DYG|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834467|pdb|213L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 Back     alignment and structure
>gi|37927383|pdb|1P2R|A Chain A, T4 Lysozyme Core Repacking Mutant I78vTA Length = 164 Back     alignment and structure
>gi|157834489|pdb|232L|A Chain A, T4 Lysozyme Mutant M120k Length = 164 Back     alignment and structure
>gi|317455410|pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>gi|37927410|pdb|1P64|A Chain A, T4 Lysozyme Core Repacking Mutant L133fTA Length = 164 Back     alignment and structure
>gi|157834487|pdb|230L|A Chain A, T4 Lysozyme Mutant M6l Length = 164 Back     alignment and structure
>gi|6729781|pdb|1CU3|A Chain A, T4 Lysozyme Mutant V87m Length = 164 Back     alignment and structure
>gi|110590780|pdb|2A4T|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (V131r7) Length = 164 Back     alignment and structure
>gi|20150496|pdb|1JQU|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 Back     alignment and structure
>gi|157831689|pdb|1L33|A Chain A, Contributions Of Left-Handed Helical Residues To The Structure And Stability Of Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|20150541|pdb|1JTM|A Chain A, Alternative Structures Of A Sequence Extended T4 Lysozyme Show That The Highly Conserved Beta-Sheet Has Weak Intrinsic Folding Propensity Length = 178 Back     alignment and structure
>gi|157829593|pdb|160L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|37927406|pdb|1P46|A Chain A, T4 Lysozyme Core Repacking Mutant M106iTA Length = 164 Back     alignment and structure
>gi|14488753|pdb|1G0Q|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149i Length = 164 Back     alignment and structure
>gi|37927589|pdb|1PQM|A Chain A, T4 Lysozyme Core Repacking Mutant V149iT152VTA Length = 164 Back     alignment and structure
>gi|157833964|pdb|1TLA|A Chain A, Hydrophobic Core Repacking And Aromatic-Aromatic Interaction In The Thermostable Mutant Of T4 Lysozyme Ser 117 (Right Arrow) Phe Length = 164 Back     alignment and structure
>gi|157829596|pdb|163L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|31615480|pdb|1KW7|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|6729796|pdb|1D3F|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|223673921|pdb|3CDR|A Chain A, R96q Mutant Of Wildtype Phage T4 Lysozyme At 298 K Length = 164 Back     alignment and structure
>gi|157831727|pdb|1L71|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164 Back     alignment and structure
>gi|9257165|pdb|1CV1|A Chain A, T4 Lysozyme Mutant V111m Length = 164 Back     alignment and structure
>gi|4930159|pdb|259L|A Chain A, An Adaptable Metal-Binding Site Engineered Into T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834490|pdb|233L|A Chain A, T4 Lysozyme Mutant M120l Length = 164 Back     alignment and structure
>gi|37927376|pdb|1P2L|A Chain A, T4 Lysozyme Core Repacking Mutant V87iTA Length = 164 Back     alignment and structure
>gi|157829551|pdb|123L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829547|pdb|119L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829548|pdb|120L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834454|pdb|206L|A Chain A, Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729784|pdb|1CUP|A Chain A, Methionine Core Mutant Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834475|pdb|221L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|37927583|pdb|1PQJ|A Chain A, T4 Lysozyme Core Repacking Mutant A111vCORE10TA Length = 164 Back     alignment and structure
>gi|37927425|pdb|1P6Y|A Chain A, T4 Lysozyme Core Repacking Mutant M120yTA Length = 164 Back     alignment and structure
>gi|157829555|pdb|128L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157830903|pdb|1DYE|A Chain A, Determination Of Alpha-Helix Propensity Within The Context Of A Folded Protein: Sites 44 And 131 In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834479|pdb|224L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831717|pdb|1L61|A Chain A, Analysis Of The Interaction Between Charged Side Chains And The Alpha-Helix Dipole Using Designed Thermostable Mutants Of Phage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831720|pdb|1L64|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|146387591|pdb|2O79|A Chain A, T4 Lysozyme With C-Terminal Extension Length = 170 Back     alignment and structure
>gi|157829541|pdb|112L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|151567976|pdb|2Q9D|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant A41r1 Length = 164 Back     alignment and structure
>gi|114793376|pdb|1ZYT|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (A82r1) Length = 164 Back     alignment and structure
>gi|5542484|pdb|1QTB|A Chain A, The Introduction Of Strain And Its Effects On The Structure And Stability Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|157831750|pdb|1L95|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|14277902|pdb|1G1V|A Chain A, T4 Lysozyme Mutant C54tC97AI58T Length = 164 Back     alignment and structure
>gi|157831741|pdb|1L86|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|10835387|pdb|1C6P|A Chain A, T4 Lysozyme Mutant C54tC97A IN THE PRESENCE OF 8 ATM ARGON Length = 164 Back     alignment and structure
>gi|14488750|pdb|1G0L|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152v Length = 164 Back     alignment and structure
>gi|157829601|pdb|170L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829533|pdb|108L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829537|pdb|110L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829544|pdb|114L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831742|pdb|1L87|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|14488744|pdb|1G06|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149s Length = 164 Back     alignment and structure
>gi|157829558|pdb|130L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|14488748|pdb|1G0J|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152s Length = 164 Back     alignment and structure
>gi|31615541|pdb|1LWG|A Chain A, Multiple Methionine Substitutions Are Tolerated In T4 Lysozyme And Have Coupled Effects On Folding And Stability Length = 164 Back     alignment and structure
>gi|157829539|pdb|111L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829545|pdb|115L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831679|pdb|1L23|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 Back     alignment and structure
>gi|157829553|pdb|126L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|14488751|pdb|1G0M|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152i Length = 164 Back     alignment and structure
>gi|5822381|pdb|1QUG|A Chain A, E108v Mutant Of T4 Lysozyme Length = 162 Back     alignment and structure
>gi|21466123|pdb|1LLH|A Chain A, Are Carboxy Terminii Of Helices Coded By The Local Sequence Or By Tertiary Structure Contacts Length = 164 Back     alignment and structure
>gi|157834495|pdb|238L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|575962|pdb|137L|A Chain A, Structural Basis Of Amino Acid Alpha Helix Propensity Length = 164 Back     alignment and structure
>gi|9257162|pdb|1CU2|A Chain A, T4 Lysozyme Mutant L84m Length = 164 Back     alignment and structure
>gi|37927385|pdb|1P36|A Chain A, T4 Lyoszyme Core Repacking Mutant I100vTA Length = 164 Back     alignment and structure
>gi|157829531|pdb|107L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157831722|pdb|1L66|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157829602|pdb|171L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834491|pdb|234L|A Chain A, T4 Lysozyme Mutant M106l Length = 164 Back     alignment and structure
>gi|157829599|pdb|166L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|14488752|pdb|1G0P|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149g Length = 164 Back     alignment and structure
>gi|157835299|pdb|2L78|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829550|pdb|122L|A Chain A, The Energetic Cost And The Structural Consequences Of Burying A Hydroxyl Group Within The Core Of A Protein Determined From Ala To Ser And Val To Thr Substitutions In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|229597880|pdb|3G3W|A Chain A, Crystal Structure Of Spin Labeled T4 Lysozyme (T151r1) At 291 K Length = 164 Back     alignment and structure
>gi|157829603|pdb|172L|A Chain A, Protein Flexibility And Adaptability Seen In 25 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834470|pdb|217L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157829535|pdb|109L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|6729782|pdb|1CU5|A Chain A, T4 Lysozyme Mutant L91m Length = 164 Back     alignment and structure
>gi|157831743|pdb|1L88|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|10835363|pdb|1C60|A Chain A, T4 Lysozyme Mutant C54tC97AF153A IN THE PRESENCE OF 8 ATM Argon Length = 164 Back     alignment and structure
>gi|157829582|pdb|149L|A Chain A, Conservation Of Solvent-Binding Sites In 10 Crystal Forms Of T4 Lysozyme Length = 164 Back     alignment and structure
>gi|7767116|pdb|1EPY|A Chain A, T4 Lysozyme Mutant, T21hC54TC97AQ141HT142H Length = 164 Back     alignment and structure
>gi|157829556|pdb|129L|A Chain A, Structures Of Randomly Generated Mutants Of T4 Lysozyme Show That Protein Stability Can Be Enhanced By Relaxation Of Strain And By Improved Hydrogen Bonding Via Bound Solvent Length = 164 Back     alignment and structure
>gi|157831695|pdb|1L39|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 Back     alignment and structure
>gi|157834504|pdb|247L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729795|pdb|1D2Y|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|157831723|pdb|1L67|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157879603|pdb|1P56|A Chain A, Duplication-Extension Of Helix A Of T4 Lysozyme Length = 176 Back     alignment and structure
>gi|157831724|pdb|1L68|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157834494|pdb|237L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729791|pdb|1CV6|A Chain A, T4 Lysozyme Mutant V149m Length = 164 Back     alignment and structure
>gi|157834499|pdb|242L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831721|pdb|1L65|A Chain A, Tolerance Of T4 Lysozyme To Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines Length = 164 Back     alignment and structure
>gi|157831680|pdb|1L24|A Chain A, Enhanced Protein Thermostability From Site-Directed Mutations That Decrease The Entropy Of Unfolding Length = 164 Back     alignment and structure
>gi|14488747|pdb|1G0G|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152a Length = 164 Back     alignment and structure
>gi|157829598|pdb|165L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|37927591|pdb|1PQO|A Chain A, T4 Lysozyme Core Repacking Mutant L118iTA Length = 164 Back     alignment and structure
>gi|6729789|pdb|1CV4|A Chain A, T4 Lysozyme Mutant L118m Length = 164 Back     alignment and structure
>gi|157834493|pdb|236L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|6729797|pdb|1D3J|A Chain A, N-Terminal Domain Core Methionine Mutation Length = 164 Back     alignment and structure
>gi|157834501|pdb|244L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|157831703|pdb|1L47|A Chain A, Cumulative Site-Directed Charge-Change Replacements In Bacteriophage T4 Lysozyme Suggest That Long-Range Electrostatic Interactions Contribute Little To Protein Stability Length = 164 Back     alignment and structure
>gi|118137975|pdb|2HUL|A Chain A, Crystal Structure Of T4 Lysozyme S44c Synthetic Dimer Length = 164 Back     alignment and structure
>gi|157829588|pdb|155L|A Chain A, Control Of Enzyme Activity By An Engineered Disulfide Bond Length = 164 Back     alignment and structure
>gi|157829543|pdb|113L|A Chain A, Structural Basis Of Alpha-Helix Propensity At Two Sites In T4 Lysozyme Length = 164 Back     alignment and structure
>gi|157834500|pdb|243L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164 Back     alignment and structure
>gi|14488745|pdb|1G07|A Chain A, Crystal Structure Of T4 Lysozyme Mutant V149c Length = 164 Back     alignment and structure
>gi|14488749|pdb|1G0K|A Chain A, Crystal Structure Of T4 Lysozyme Mutant T152c Length = 164 Back     alignment and structure
>gi|157831749|pdb|1L94|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|149242169|pdb|2IGC|A Chain A, Structure Of Spin Labeled T4 Lysozyme Mutant T115r1a Length = 164 Back     alignment and structure
>gi|157831697|pdb|1L41|A Chain A, Contributions Of Engineered Surface Salt Bridges To The Stability Of T4 Lysozyme Determined By Directed Mutagenesis Length = 164 Back     alignment and structure
>gi|494717|pdb|201L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 166 Back     alignment and structure
>gi|157831747|pdb|1L92|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157834466|pdb|212L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 168 Back     alignment and structure
>gi|37927436|pdb|1P7S|A Chain A, T4 Lysozyme Core Repacking Mutant V103iTA Length = 164 Back     alignment and structure
>gi|443083|pdb|1L97|A Chain A, Structure Of A Hinge-Bending Bacteriophage T4 Lysozyme Mutant, Ile3-> Pro Length = 164 Back     alignment and structure
>gi|157829524|pdb|102L|A Chain A, How Amino-Acid Insertions Are Allowed In An Alpha-Helix Of T4 Lysozyme Length = 165 Back     alignment and structure
>gi|157831748|pdb|1L93|A Chain A, Similar Hydrophobic Replacements Of Leu 99 And Phe 153 Within The Core Of T4 Lysozyme Have Different Structural And Thermodynamic Consequences Length = 164 Back     alignment and structure
>gi|157831901|pdb|1LYF|A Chain A, Dissection Of Helix Capping In T4 Lysozyme By Structural And Thermodynamic Analysis Of Six Amino Acid Substitutions At Thr 59 Length = 164 Back     alignment and structure
>gi|149242489|pdb|2NTH|A Chain A, Structure Of Spin-Labeled T4 Lysozyme Mutant L118r1 Length = 164 Back     alignment and structure
>gi|157834465|pdb|211L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165 Back