254781059

254781059

cysteine desulfurase activator complex subunit SufB

GeneID in NCBI database:8210082Locus tag:CLIBASIA_04805
Protein GI in NCBI database:254781059Protein Accession:YP_003065472.1
Gene range:+(1062677, 1064146)Protein Length:489aa
Gene description:cysteine desulfurase activator complex subunit SufB
COG prediction:[O] ABC-type transport system involved in Fe-S cluster assembly, permease component
KEGG prediction:sufB; cysteine desulfurase activator complex subunit SufB; K09014 Fe-S cluster assembly protein SufB
SEED prediction:Iron-sulfur cluster assembly protein SufB
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Fe-S cluster assembly
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG
cccccccccccccccccccccccEEcHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccccccccHHHccHHHHHHHHHcccccHHHHHHcccccccEEEEEEEcccHHHHHHHHHHHHccEEEEEHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccEEEEEcccccccccEEEEEEEccccccEEEEEEEEEccccEEEEEEEEEcccccccccccEEEEEEEccccEEEEEEEEccccccccccccEEEEEEEEEEEEccccEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEccccEEEEcccEEEEEccccEEEEEEEEEEccccEEEEEEEEEEcccccccccEEEccEEEEccccEEEcccEEEEEccccEEEEEEEEccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccc
ccccHHHHHHHHHHHHccHccccEEEEEcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccEccccccccccEEEEccccccccccccccccHHHHHHHHHccccccHHHHHccccccccEEEEcccccEHHHHHHHHHHHcccEEEccHHHHHHcHHHHHHHHcccccccccHHHHHHHHccccccEEEcccccccccccccEEEEccccccccEEEEEEEEcccEEEEEEcccccccccccHccEEEEEEEcccccEEEccccccccccccccccEEccEEEcccccccccEEEEEEEEcccEEEEcccEEEEEccccccEEEEEEEEccccEcccccEEEEEccccccEEEEccEEccccccccccEEEEcccccccccccccccEEEccccccccccEEEEEccccEEEEEcccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcEEEccccc
MVAVRETVDKVRKIdvdqykygfetniqvdkapkglnEDIIRFISAKKNEPDWMLEWRLLAYRRWLTmkdpswarirypaidfddlyyyaapksivgpqslddvdpELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSavftdgsfvyipkgvrcpmelSTYFRinekgtgqfeRTLIIadegsyvsylegctapqrdeNQLHAAVVELVALDNaeikystvqnwypgdsqgkggiynfvtkrgdcrgmrskiswtqletgsaitwkypscllrgeqscgEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKgisagfsnntyrgkvsvhrgaahsrnftqcdsllignncgahtipyiesknsscnleheattskisdEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG
mvavretvdkvrkidvdqykygfetniqvdkapkglNEDIIRFIsakknepdwmLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKsivgpqslddvdPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRInekgtgqfERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYStvqnwypgdsqgkgGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIvskgisagfsnntyRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKlidislegsvg
MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSkvavdavfdsvsvvttfkEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG
**************DVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYA***************PELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV**********NTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS**
MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG
***VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG
MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG
MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target489 cysteine desulfurase activator complex subunit SufB [Ca
254781061428 putative iron-sulfur cluster assembly protein [Can 2e-11
>gi|254781061|ref|YP_003065474.1| putative iron-sulfur cluster assembly protein [Candidatus Liberibacter asiaticus str. psy62] Length = 428 Back     alignment
 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 79/174 (45%), Gaps = 3/174 (1%)

Query: 305 RSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTS 364
           +S +    L  G  ++ +  S  ++GE+S      I + +G    D    + H   NT S
Sbjct: 238 KSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCS 297

Query: 365 RIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCN 424
             V + I    S   ++G V V   A  S      ++LL  N    +  P +E       
Sbjct: 298 TSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQ 357

Query: 425 LEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLP---MEFAVE 475
             H AT S I+ EHL+Y + RGI +  A +++ + F+ E+++ L    ++F++E
Sbjct: 358 CGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIE 411

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target489 cysteine desulfurase activator complex subunit SufB [Ca
315122394489 cysteine desulfurase activator complex subunit SufB [Ca 1 0.0
222148789489 cysteine desulfurase activator complex subunit SufB [Ag 1 0.0
150396681489 cysteine desulfurase activator complex subunit SufB [Si 1 0.0
86357868489 cysteine desulfurase activator complex subunit SufB [Rh 1 0.0
227822091489 cysteine desulfurase activator complex subunit SufB [Si 1 0.0
15965488489 cysteine desulfurase activator complex subunit SufB [Si 1 0.0
209549494489 cysteine desulfurase activator complex subunit SufB [Rh 1 0.0
190891952489 ABC transporter involved in Fe-S cluster assembly, perm 1 0.0
116252328489 cysteine desulfurase activator complex subunit SufB [Rh 1 0.0
222086103489 FeS assembly protein SufB [Agrobacterium radiobacter K8 1 0.0
>gi|315122394|ref|YP_004062883.1| cysteine desulfurase activator complex subunit SufB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 489 Back     alignment and organism information
 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/489 (89%), Positives = 473/489 (96%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M+AV++T+D+VR I+VDQYKYGFETNI+V+++P+GLNED+IRFISAKKNEP+WMLEWRL 
Sbjct: 1   MIAVQKTIDQVRDIEVDQYKYGFETNIEVERSPRGLNEDVIRFISAKKNEPEWMLEWRLS 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWL MK+PSWAR+ YP IDF+ LYYY++PKS VGP+SLD+VDPELLR Y+KLGIP+ 
Sbjct: 61  AYRRWLKMKEPSWARVHYPPIDFNSLYYYSSPKSFVGPRSLDEVDPELLRMYDKLGIPLH 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQE LAGVQTSKVAVDA+FDSVS+VTTFKEELKKSG+IFMPISEAI EH DLVKKYLS+V
Sbjct: 121 EQEALAGVQTSKVAVDAIFDSVSIVTTFKEELKKSGIIFMPISEAIHEHSDLVKKYLSSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DNFYAALNSAVFTDGSFVYIPKG+RCPMELSTYFRINE+ TGQFERTLIIADEGSY
Sbjct: 181 VPVADNFYAALNSAVFTDGSFVYIPKGIRCPMELSTYFRINERETGQFERTLIIADEGSY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP+RDENQLHAAVVELVALD+AEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPKRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG+RSKISWTQLETGSAITWKYPSCLLRGE SCGEFYSIAISNGFQQIDSGTKMLHLAK
Sbjct: 301 CRGIRSKISWTQLETGSAITWKYPSCLLRGEYSCGEFYSIAISNGFQQIDSGTKMLHLAK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NTTSRIVSKGISAGFSNNTYRGKVSVHRGA HSRNFTQCDSLLIGNNCGAHT+PYIE+KN
Sbjct: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGATHSRNFTQCDSLLIGNNCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           SSCNLEHEATTSKISD+HLFYCLQRGIPEEAAIALI+NGFV+EVLQKLPMEFAVEAQKLI
Sbjct: 421 SSCNLEHEATTSKISDDHLFYCLQRGIPEEAAIALIINGFVKEVLQKLPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
           DISLEGSVG
Sbjct: 481 DISLEGSVG 489


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148789|ref|YP_002549746.1| cysteine desulfurase activator complex subunit SufB [Agrobacterium vitis S4] Length = 489 Back     alignment and organism information
>gi|150396681|ref|YP_001327148.1| cysteine desulfurase activator complex subunit SufB [Sinorhizobium medicae WSM419] Length = 489 Back     alignment and organism information
>gi|86357868|ref|YP_469760.1| cysteine desulfurase activator complex subunit SufB [Rhizobium etli CFN 42] Length = 489 Back     alignment and organism information
>gi|227822091|ref|YP_002826062.1| cysteine desulfurase activator complex subunit SufB [Sinorhizobium fredii NGR234] Length = 489 Back     alignment and organism information
>gi|15965488|ref|NP_385841.1| cysteine desulfurase activator complex subunit SufB [Sinorhizobium meliloti 1021] Length = 489 Back     alignment and organism information
>gi|209549494|ref|YP_002281411.1| cysteine desulfurase activator complex subunit SufB [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 489 Back     alignment and organism information
>gi|190891952|ref|YP_001978494.1| ABC transporter involved in Fe-S cluster assembly, permease [Rhizobium etli CIAT 652] Length = 489 Back     alignment and organism information
>gi|116252328|ref|YP_768166.1| cysteine desulfurase activator complex subunit SufB [Rhizobium leguminosarum bv. viciae 3841] Length = 489 Back     alignment and organism information
>gi|222086103|ref|YP_002544635.1| FeS assembly protein SufB [Agrobacterium radiobacter K84] Length = 489 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target489 cysteine desulfurase activator complex subunit SufB [Ca
PRK11814486 PRK11814, PRK11814, cysteine desulfurase activator comp 0.0
TIGR01980448 TIGR01980, sufB, FeS assembly protein SufB 0.0
CHL00085485 CHL00085, ycf24, putative ABC transporter 0.0
COG0719412 COG0719, SufB, ABC-type transport system involved in Fe 1e-121
pfam01458230 pfam01458, UPF0051, Uncharacterized protein family (UPF 4e-55
TIGR01981366 TIGR01981, sufD, FeS assembly protein SufD, group 1 1e-38
PRK10948424 PRK10948, PRK10948, cysteine desulfurase activator comp 3e-07
>gnl|CDD|183322 PRK11814, PRK11814, cysteine desulfurase activator complex subunit SufB; Provisional Back     alignment and domain information
>gnl|CDD|131035 TIGR01980, sufB, FeS assembly protein SufB Back     alignment and domain information
>gnl|CDD|177024 CHL00085, ycf24, putative ABC transporter Back     alignment and domain information
>gnl|CDD|31063 COG0719, SufB, ABC-type transport system involved in Fe-S cluster assembly, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|144885 pfam01458, UPF0051, Uncharacterized protein family (UPF0051) Back     alignment and domain information
>gnl|CDD|162637 TIGR01981, sufD, FeS assembly protein SufD, group 1 Back     alignment and domain information
>gnl|CDD|182859 PRK10948, PRK10948, cysteine desulfurase activator complex subunit SufD; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 489 cysteine desulfurase activator complex subunit SufB [Ca
TIGR01980469 sufB FeS assembly protein SufB; InterPro: IPR010231 Iro 100.0
PRK11814484 cysteine desulfurase activator complex subunit SufB; Pr 100.0
CHL00085485 ycf24 putative ABC transporter 100.0
COG0719412 SufB Cysteine desulfurase activator SufB [Posttranslati 100.0
PRK10948424 cysteine desulfurase activator complex subunit SufD; Pr 100.0
TIGR01981397 sufD FeS assembly protein SufD; InterPro: IPR011542 Iro 100.0
pfam01458230 UPF0051 Uncharacterized protein family (UPF0051). 100.0
CHL00085485 ycf24 putative ABC transporter 97.8
pfam01458230 UPF0051 Uncharacterized protein family (UPF0051). 98.7
COG0719412 SufB Cysteine desulfurase activator SufB [Posttranslati 98.19
TIGR01981397 sufD FeS assembly protein SufD; InterPro: IPR011542 Iro 98.11
PRK10948424 cysteine desulfurase activator complex subunit SufD; Pr 97.87
PRK11814484 cysteine desulfurase activator complex subunit SufB; Pr 97.3
TIGR01980469 sufB FeS assembly protein SufB; InterPro: IPR010231 Iro 95.7
>TIGR01980 sufB FeS assembly protein SufB; InterPro: IPR010231 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>PRK11814 cysteine desulfurase activator complex subunit SufB; Provisional Back     alignment and domain information
>CHL00085 ycf24 putative ABC transporter Back     alignment and domain information
>COG0719 SufB Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10948 cysteine desulfurase activator complex subunit SufD; Provisional Back     alignment and domain information
>TIGR01981 sufD FeS assembly protein SufD; InterPro: IPR011542 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>pfam01458 UPF0051 Uncharacterized protein family (UPF0051) Back     alignment and domain information
>CHL00085 ycf24 putative ABC transporter Back     alignment and domain information
>pfam01458 UPF0051 Uncharacterized protein family (UPF0051) Back     alignment and domain information
>COG0719 SufB Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01981 sufD FeS assembly protein SufD; InterPro: IPR011542 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>PRK10948 cysteine desulfurase activator complex subunit SufD; Provisional Back     alignment and domain information
>PRK11814 cysteine desulfurase activator complex subunit SufB; Provisional Back     alignment and domain information
>TIGR01980 sufB FeS assembly protein SufB; InterPro: IPR010231 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target489 cysteine desulfurase activator complex subunit SufB [Ca
1vh4_A435 Crystal Structure Of A Stabilizer Of Iron Transport 1e-50
2zu0_A423 Crystal Structure Of Sufc-Sufd Complex Involved In 1e-50
>gi|40889898|pdb|1VH4|A Chain A, Crystal Structure Of A Stabilizer Of Iron Transporter Length = 435 Back     alignment and structure
 Score =  205 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 56/287 (19%), Positives = 98/287 (34%), Gaps = 15/287 (5%)

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRIN-----EKGTGQFERTLIIADEGSYVSYL 244
            L  ++    + + + +G R    L            E  T  +   L    EG+  + +
Sbjct: 130 HLTESLAQSVTHIAVKRGQRPAKPLLLMHITQGVAGEEVNTAHYRHHL-DLAEGAEATVI 188

Query: 245 EGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGM 304
           E   +          A   +    NA +++  +    P                      
Sbjct: 189 EHFVSLND-ARHFTGARFTINVAANAHLQHIKLAFENPLSHHFAHN--------DLLLAE 239

Query: 305 RSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTS 364
            +         G A+     S  L GE S     S+A+    +  D+ T + H      S
Sbjct: 240 DATAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNS 299

Query: 365 RIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCN 424
           R + K I +      + G ++V + A  +      ++LL+G      T P +E       
Sbjct: 300 RQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVK 359

Query: 425 LEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
             H AT  +I DE +FY   RGI ++ A  +I+  F  E+ + L  E
Sbjct: 360 CSHGATVGRIDDEQIFYLRSRGINQQDAQQMIIYAFAAELTEALRDE 406


gi|224983401|pdb|2ZU0|A Chain A, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 423 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target489 cysteine desulfurase activator complex subunit SufB [Ca
1vh4_A435 SUFD protein; structural genomics, protein binding prot 6e-44
>1vh4_A SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} SCOP: b.80.6.1 PDB: 2zu0_A* Length = 435 Back     alignment and structure
 Score =  174 bits (440), Expect = 6e-44
 Identities = 73/403 (18%), Positives = 133/403 (33%), Gaps = 33/403 (8%)

Query: 109 LRTYEKLGIPIREQEI-----LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMP-- 161
           L+   + G+P R+ E      L G+  S+    A   S          L    ++F+   
Sbjct: 35  LQQLLRTGLPTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRLVFVDGR 94

Query: 162 ISEAICEHPDLVK-------KYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMEL 214
              A+ +  +                  +    +  L  ++    + + + +G R    L
Sbjct: 95  YVPALSDATEGSGYEVSINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPL 154

Query: 215 STYF----RINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNA 270
                      E+      R  +   EG+  + +E   +          A   +    NA
Sbjct: 155 LLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDA-RHFTGARFTINVAANA 213

Query: 271 EIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRG 330
            +++  +    P          +            +         G A+     S  L G
Sbjct: 214 HLQHIKLAFENPL--------SHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNG 265

Query: 331 EQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGA 390
           E S     S+A+    +  D+ T + H      SR + K I +      + G ++V + A
Sbjct: 266 ENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHA 325

Query: 391 AHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEE 450
             +      ++LL+G      T P +E         H AT  +I DE +FY   RGI ++
Sbjct: 326 IKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQ 385

Query: 451 AAIALIVNGFVREVLQKLPME------FAVEAQKLIDISLEGS 487
            A  +I+  F  E+ + L  E       A   Q+L   + EG 
Sbjct: 386 DAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPGGAREGG 428


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target489 cysteine desulfurase activator complex subunit SufB [Ca
1vh4_A435 SUFD protein; structural genomics, protein binding prot 100.0
1vh4_A435 SUFD protein; structural genomics, protein binding prot 98.3
>1vh4_A SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} SCOP: b.80.6.1 PDB: 2zu0_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=602.81  Aligned_cols=402  Identities=17%  Similarity=0.175  Sum_probs=329.2

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHH
Q ss_conf             99986329988999999999999996887786658766568200031005653334332101587888877651765111
Q gi|254781059|r   42 RFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIRE  121 (489)
Q Consensus        42 ~~iS~~k~EP~Wl~e~R~~Al~~f~~l~~P~W~~~~l~~i~~~~i~~~~~p~~~~~~~sld~v~~ei~~tf~kLgip~~e  121 (489)
                      +.+...+++|.  ...|++||+.|.++|+|+   .+.+.|+|+++.........+...   +..+.....+.   .    
T Consensus        17 ~~~~~~~~~~~--~~~~~~~~~~f~~~GlPt---~K~E~WKyT~l~~l~~~~~~~~~~---~~~~~~~~~~~---~----   81 (435)
T 1vh4_A           17 HHLFEAEGTKR--SPQAQQHLQQLLRTGLPT---RKHENWKYTPLEGLINSQFVSIAG---EISPQQRDALA---L----   81 (435)
T ss_dssp             HHHHHC---CC--CHHHHHHHHHHHHHCCCC---TTSTTCTTCCCHHHHTSCEECCCC---CCCHHHHHHHC---C----
T ss_pred             HHHHHHCCCCC--CHHHHHHHHHHHHHCCCC---CCCCCEECCCHHHHHCCCCCCCCC---CCCHHHHCCCC---C----
T ss_conf             99998528745--099999999999838889---986272059779974457765577---67801201122---3----


Q ss_pred             HHHHCCCCCCCCEEEEEECCEEEECCCHHHHHHCCEEEEEHHHHHHHHHHHHHHHCCCEECCCCCHHHHHHHHHHCCCEE
Q ss_conf             11102344443100012135022020056787479088558998777789886202211245653146688764238438
Q gi|254781059|r  122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSF  201 (489)
Q Consensus       122 ~~~l~g~~~~~v~v~~~~ds~~v~~~l~~~L~~~GVi~~~l~eA~~~~p~lv~~~~~~~~~~~~~~f~aLn~A~~~~G~f  201 (489)
                          .......++++++++..     +.+.....|+.++.++++.. .++          ....++|++||.|++++|.+
T Consensus        82 ----~~~~~~ivfvnG~~~~~-----lS~~~e~~~i~i~~~~~~~~-~~~----------~~~~~~~~~Ln~a~~~~g~~  141 (435)
T 1vh4_A           82 ----TLDSVRLVFVDGRYVPA-----LSDATEGSGYEVSINDDRQG-LPD----------AIQAEVFLHLTESLAQSVTH  141 (435)
T ss_dssp             ----CCCSEEEEEETTEECGG-----GSCCCTTSSCEEEEESCCTT-CCC----------CSSCCHHHHHHHHHCSCEEE
T ss_pred             ----CCCCEEEEEECCEECHH-----HCCCCCCCCEEEECHHHHHH-HHH----------HHCCCHHHHHHHHHHCCEEE
T ss_conf             ----47853899999998132-----26775568729952677654-044----------43010779998865346479


Q ss_pred             EEECCCCCCCCCEEEEEEECCCC----CEECCEEEEEEECCCEEEEEECCCCCCCCCCCCCCEEEEEEECCCCEEEEEEE
Q ss_conf             87347741342127999965888----40022148997277249999615676544444433058998669958999996
Q gi|254781059|r  202 VYIPKGVRCPMELSTYFRINEKG----TGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTV  277 (489)
Q Consensus       202 i~Vp~gv~v~~PI~~~~~~~~~~----~~~f~r~lIi~ee~S~v~~iE~~~s~~~~~~~~~~~v~Ei~vg~nA~v~~~~i  277 (489)
                      |+||+|++++.||++++..+...    ...+||++|++++||+++++|.|.+.. ...++++.++|+++++||+|+|+.+
T Consensus       142 I~V~~n~~~~~PI~I~~~~~~~~~~~~~~~~~r~~I~v~~ns~vtIie~~~~~~-~~~~~~n~v~ei~l~enA~L~~~~i  220 (435)
T 1vh4_A          142 IAVKRGQRPAKPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLN-DARHFTGARFTINVAANAHLQHIKL  220 (435)
T ss_dssp             EEECTTCCCSSCEEEEEEECCCSSSCEEEEEEEEEEEECTTCEEEEEEEEEESS-SSCEEEEEEEEEEECTTCEEEEEEE
T ss_pred             EEEECCEECCCCEEEEEEECCCCCCCCCEEEEEEEEEECCCCCEEEEEEEECCC-CCCCEEEEEEEEEEECCEEEEEEEE
T ss_conf             997034001564599996124466555303467899974898527999750378-6410231369999807808999998


Q ss_pred             EECCCCCCCCCCCEEEEEEEEEEEECCCEEEEEEEEEECCCEEEEEEEEEEECCCCEEEEEEEEEECCCEEEEEEEEEEE
Q ss_conf             30475531144874640146786304630389988751463478853899827872799998776259868997218998
Q gi|254781059|r  278 QNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLH  357 (489)
Q Consensus       278 Qn~~~~~~~~~~~~~~~~t~r~~~~~~~a~~~~~~~~lG~~~~r~~~~~~L~G~~a~~~~~gi~l~~~~Q~~D~~~~v~H  357 (489)
                      |+|..       +.+++.+.++.+ +++|.++|+++.+|+..+|.++.+.|.|+||.++++|++++.++|++|+++.++|
T Consensus       221 q~~~~-------~~~~~~~~~~~~-~~~S~~~~~~~~~g~~~~r~~~~~~L~G~ga~~~~~g~~~~~~~q~~D~~~~i~H  292 (435)
T 1vh4_A          221 AFENP-------LSHHFAHNDLLL-AEDATAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMPVKNEVCDTRTWLEH  292 (435)
T ss_dssp             ECCCT-------TCEEEEEEEEEE-CTTCEEEEEEEECCCSEEEEEEEEEECSTTCEEEEEEEECCCTTCEEEEEEEEEE
T ss_pred             ECCCC-------CCCEEEEEEEEE-CCCCCEEEEEEECCCCEEEEECCCCCCCCCCEEEEEEEEECCCCEEEEEEEEEEE
T ss_conf             50577-------541000236886-4787369988851774147620111456643045666772589868852100042


Q ss_pred             ECCCCCCEEEEEEEECCCCEEEEEEEEEECCCCCCCCCEEEEEEEEECCCCEEEEEEEEEEECCCCEEEEEEEECCCCHH
Q ss_conf             36766110100001058946899401473388658743022105884598548622368983487568875320247999
Q gi|254781059|r  358 LAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDE  437 (489)
Q Consensus       358 ~~p~t~S~~~~K~i~~d~s~~~f~G~i~v~~~A~~t~~~~~~~~LlLs~~a~~~s~P~LeI~~ddv~~~H~Atvg~id~e  437 (489)
                      .+|+|+|+|++|||+.|+|+++|+|+|.|.++|++|+|+|.|++||||++|+++|+|.|||++|||+|+||||||+||+|
T Consensus       293 ~~~~t~S~~~~k~Vl~d~s~~vf~G~i~I~~~A~~t~a~q~~~~llls~~a~~~s~P~LeI~~ddV~~sHgatvg~id~e  372 (435)
T 1vh4_A          293 NKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDE  372 (435)
T ss_dssp             CSSSCEEEEEEEEEECTTCEEEEEEEEEECTTCTTEEEEEEEEEEECSTTCEEEEEEEEEECCSSEEEEEEEEEECCCHH
T ss_pred             CCCCCEEEEEEECCCCCCCCEEEEEEEEECCCCHHHHHHHEECEEEECCCCEEEECEEEEEECCCEEEEEEEECCCCCHH
T ss_conf             37980688721023226870499630200555126666320043981488348765048995397379951324678989


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCHHHH-HHHHHHHHHHHCCC
Q ss_conf             999998378898999999999989999885896899-99999999870135
Q gi|254781059|r  438 HLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA-VEAQKLIDISLEGS  487 (489)
Q Consensus       438 ~LFYL~sRGi~~~~A~~liv~gF~~~v~~~ip~e~~-~e~~~li~~~~e~~  487 (489)
                      ||||||||||++++|++|||.||+.||+++||.|.. ..+..+|+.+|+|.
T Consensus       373 ~lfYL~SRGi~~~~A~~llv~gF~~~v~~~i~~~~l~~~v~~~i~~~l~~~  423 (435)
T 1vh4_A          373 QIFYLRSRGINQQDAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPGG  423 (435)
T ss_dssp             HHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHTTSTTC
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCH
T ss_conf             999998769999999999999979999986996999999999999874130



>1vh4_A SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} SCOP: b.80.6.1 PDB: 2zu0_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 489 cysteine desulfurase activator complex subunit SufB [Ca
d1vh4a_413 b.80.6.1 (A:) Stabilizer of iron transporter SufD {Esch 6e-41
>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Length = 413 Back     information, alignment and structure

class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Stabilizer of iron transporter SufD
family: Stabilizer of iron transporter SufD
domain: Stabilizer of iron transporter SufD
species: Escherichia coli [TaxId: 562]
 Score =  162 bits (410), Expect = 6e-41
 Identities = 72/397 (18%), Positives = 131/397 (32%), Gaps = 28/397 (7%)

Query: 109 LRTYEKLGIPIREQEI-----LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMP-- 161
           L+   + G+P R+ E      L G+  S+    A   S          L    ++F+   
Sbjct: 25  LQQLLRTGLPTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRLVFVDGR 84

Query: 162 ISEAICEHPDLVK-------KYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMEL 214
              A+ +  +                  +    +  L  ++    + + + +G R    L
Sbjct: 85  YVPALSDATEGSGYEVSINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPL 144

Query: 215 STYF----RINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNA 270
                      E+      R  +   EG+  + +E   +   D      A   +    NA
Sbjct: 145 LLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLN-DARHFTGARFTINVAANA 203

Query: 271 EIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRG 330
            +++  +    P          +            +         G A+     S  L G
Sbjct: 204 HLQHIKLAFENPL--------SHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNG 255

Query: 331 EQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGA 390
           E S     S+A+    +  D+ T + H      SR + K I +      + G ++V + A
Sbjct: 256 ENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHA 315

Query: 391 AHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEE 450
             +      ++LL+G      T P +E         H AT  +I DE +FY   RGI ++
Sbjct: 316 IKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQ 375

Query: 451 AAIALIVNGFVREVLQKLPMEFAVEA-QKLIDISLEG 486
            A  +I+  F  E+ + L  E   +     I   L G
Sbjct: 376 DAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPG 412


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target489 cysteine desulfurase activator complex subunit SufB [Ca
d1vh4a_413 Stabilizer of iron transporter SufD {Escherichia coli [ 100.0
d1vh4a_413 Stabilizer of iron transporter SufD {Escherichia coli [ 98.26
>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Stabilizer of iron transporter SufD
family: Stabilizer of iron transporter SufD
domain: Stabilizer of iron transporter SufD
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=603.65  Aligned_cols=394  Identities=18%  Similarity=0.171  Sum_probs=326.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHCCCCCC
Q ss_conf             89999999999999968877866587665682000310056533343321015878888776517651111110234444
Q gi|254781059|r   52 DWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTS  131 (489)
Q Consensus        52 ~Wl~e~R~~Al~~f~~l~~P~W~~~~l~~i~~~~i~~~~~p~~~~~~~sld~v~~ei~~tf~kLgip~~e~~~l~g~~~~  131 (489)
                      .|..+.|+++|+.|.++|+|+   .+.+.|+|+++..+......+...   +..+....... +          ......
T Consensus        15 ~~~~~~~~~~l~~f~~~GlPt---~k~E~WKyT~l~~l~~~~~~~~~~---~~~~~~~~~~~-~----------~~~~~~   77 (413)
T d1vh4a_          15 TKRSPQAQQHLQQLLRTGLPT---RKHENWKYTPLEGLINSQFVSIAG---EISPQQRDALA-L----------TLDSVR   77 (413)
T ss_dssp             -CCCHHHHHHHHHHHHHCCCC---TTSTTCTTCCCHHHHTSCEECCCC---CCCHHHHHHHC-C----------CCCSEE
T ss_pred             CCCHHHHHHHHHHHHHCCCCC---CCCCCCCCCCHHHHHCCCCCCCCC---CCCCHHHCCCC-C----------CCCCEE
T ss_conf             846299999999999729889---987281479879974357765677---66800200023-4----------568548


Q ss_pred             CCEEEEEECCEEEECCCHHHHHHCCEEEEEHHHHHHHHHHHHHHHCCCEECCCCCHHHHHHHHHHCCCEEEEECCCCCCC
Q ss_conf             31000121350220200567874790885589987777898862022112456531466887642384388734774134
Q gi|254781059|r  132 KVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCP  211 (489)
Q Consensus       132 ~v~v~~~~ds~~v~~~l~~~L~~~GVi~~~l~eA~~~~p~lv~~~~~~~~~~~~~~f~aLn~A~~~~G~fi~Vp~gv~v~  211 (489)
                      .++++++++..     +++.+...|+.++..++... .+          -....++|++||+|++++|++|+||+|++++
T Consensus        78 ivfvnG~~~~~-----ls~~~~~~~i~i~~~~~~~~-~~----------~~~~~~~~~~LN~a~~~~g~~I~V~~~~~~~  141 (413)
T d1vh4a_          78 LVFVDGRYVPA-----LSDATEGSGYEVSINDDRQG-LP----------DAIQAEVFLHLTESLAQSVTHIAVKRGQRPA  141 (413)
T ss_dssp             EEEETTEECGG-----GSCCCTTSSCEEEEESCCTT-CC----------CCSSCCHHHHHHHHHCSCEEEEEECTTCCCS
T ss_pred             EEEECCEECHH-----CCCCCCCCCEEEECHHHHHH-CC----------CCHHHHHHHHHHHHCCCCCEEEEECCCEEEC
T ss_conf             99989998210-----05675557728851575540-41----------1011001233232102543267412535760


Q ss_pred             CCEEEEEEECCC----CCEECCEEEEEEECCCEEEEEECCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEEECCCCCCCC
Q ss_conf             212799996588----8400221489972772499996156765444444330589986699589999963047553114
Q gi|254781059|r  212 MELSTYFRINEK----GTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQG  287 (489)
Q Consensus       212 ~PI~~~~~~~~~----~~~~f~r~lIi~ee~S~v~~iE~~~s~~~~~~~~~~~v~Ei~vg~nA~v~~~~iQn~~~~~~~~  287 (489)
                      +||+++|..+..    ....+||++|++++||+++++|.|.++. ...++++.++|+++++||+|+|+++|+|..     
T Consensus       142 ~PI~i~~~~~~~~~~~~~~~~~r~~I~v~ena~v~iiE~~~~~~-~~~~~~n~~~ei~l~~nA~l~~~~iq~~~~-----  215 (413)
T d1vh4a_         142 KPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLN-DARHFTGARFTINVAANAHLQHIKLAFENP-----  215 (413)
T ss_dssp             SCEEEEEEECCCSSSCEEEEEEEEEEEECTTCEEEEEEEEEESS-SSCEEEEEEEEEEECTTCEEEEEEEECCCT-----
T ss_pred             CCCEEEEEECCCCCCCCCCCCEEEEEEECCCCHHHHHHHCCCCC-CCCCEECCEEEEEECCCCEEEEHHHHHHCC-----
T ss_conf             45414675036443443331114565305520221112114554-410000220589952664243033444223-----


Q ss_pred             CCCEEEEEEEEEEEECCCEEEEEEEEEECCCEEEEEEEEEEECCCCEEEEEEEEEECCCEEEEEEEEEEEECCCCCCEEE
Q ss_conf             48746401467863046303899887514634788538998278727999987762598689972189983676611010
Q gi|254781059|r  288 KGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV  367 (489)
Q Consensus       288 ~~~~~~~~t~r~~~~~~~a~~~~~~~~lG~~~~r~~~~~~L~G~~a~~~~~gi~l~~~~Q~~D~~~~v~H~~p~t~S~~~  367 (489)
                        +.+++.+.+..+ +++|.++|..+++|+.++|.++.+.|.|++|.++++|++++.++|++|+++.|+|.+|+|+|+|+
T Consensus       216 --~~~~~~~~~~~~-~~~s~~~~~~~~~G~~~~r~~~~~~L~G~~a~~~~~g~~~~~~~q~~D~~~~i~H~~~~t~S~~~  292 (413)
T d1vh4a_         216 --LSHHFAHNDLLL-AEDATAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQL  292 (413)
T ss_dssp             --TCEEEEEEEEEE-CTTCEEEEEEEECCCSEEEEEEEEEECSTTCEEEEEEEECCCTTCEEEEEEEEEECSSSCEEEEE
T ss_pred             --CCCCCCEEEEEC-CCCCCEEEEECCCCCCHHHCCCHHHCCCCCCCCCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHH
T ss_conf             --342122011200-34541465320002110011000011200011001102346642243322232015554204134


Q ss_pred             EEEEECCCCEEEEEEEEEECCCCCCCCCEEEEEEEEECCCCEEEEEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHCCC
Q ss_conf             00010589468994014733886587430221058845985486223689834875688753202479999999983788
Q gi|254781059|r  368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGI  447 (489)
Q Consensus       368 ~K~i~~d~s~~~f~G~i~v~~~A~~t~~~~~~~~LlLs~~a~~~s~P~LeI~~ddv~~~H~Atvg~id~e~LFYL~sRGi  447 (489)
                      +|||+.|+|+++|+|+|.|.++|++|+|+|.|++||||++|+++|+|.|+|++|||+|+||||||+||+|||||||||||
T Consensus       293 ~k~vl~d~s~~vf~G~i~V~~~A~~t~a~q~~~~llls~~a~~~s~P~Lei~~ddv~~~Hgatvg~id~~~lfYL~sRGi  372 (413)
T d1vh4a_         293 HKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGI  372 (413)
T ss_dssp             EEEEECTTCEEEEEEEEEECTTCTTEEEEEEEEEEECSTTCEEEEEEEEEECCSSEEEEEEEEEECCCHHHHHHHHHTTC
T ss_pred             HHCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEECCEEEEECCCEEEEEEEECCCCCHHHHHHHHHCCC
T ss_conf             31246666404886530356552256657766530156774487552289963981699400046789899999997699


Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCHH-HHHHHHHHHHHHHCCC
Q ss_conf             989999999999899998858968-9999999999870135
Q gi|254781059|r  448 PEEAAIALIVNGFVREVLQKLPME-FAVEAQKLIDISLEGS  487 (489)
Q Consensus       448 ~~~~A~~liv~gF~~~v~~~ip~e-~~~e~~~li~~~~e~~  487 (489)
                      ++++|++|||+||+.||+++||.| ....+.++|+.+|+|.
T Consensus       373 ~~~eA~~ll~~gF~~~~~~~~~~~~~~~~~~~~i~~~l~~~  413 (413)
T d1vh4a_         373 NQQDAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPGG  413 (413)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHTTSTTC
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCC
T ss_conf             99999999999989999986982999999999999872489



>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 489 cysteine desulfurase activator complex subunit Suf
1vh4_A_435 (A:) SUFD protein; structural genomics, protein bi 1e-111
>1vh4_A (A:) SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli}Length = 435 Back     alignment and structure
 Score =  394 bits (1014), Expect = e-111
 Identities = 72/469 (15%), Positives = 147/469 (31%), Gaps = 52/469 (11%)

Query: 29  VDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYY 88
           +       +  + ++    + E            ++ L    P+            + + 
Sbjct: 2   LMAGLPNSSNALQQWHHLFEAEGTKRSPQAQQHLQQLLRTGLPTR---------KHENWK 52

Query: 89  YAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTF 148
           Y   + ++  Q +        +  + L + +    +        V VD  +         
Sbjct: 53  YTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRL--------VFVDGRYVPA------ 98

Query: 149 KEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGV 208
             +  +     + I++     P            +    +  L  ++    + + + +G 
Sbjct: 99  LSDATEGSGYEVSINDDRQGLP----------DAIQAEVFLHLTESLAQSVTHIAVKRGQ 148

Query: 209 RCPMELSTYF----RINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVEL 264
           R    L           E+      R  +   EG+  + +E   +   D      A   +
Sbjct: 149 RPAKPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSL-NDARHFTGARFTI 207

Query: 265 VALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYP 324
               NA +++  +              ++F           +         G A+     
Sbjct: 208 NVAANAHLQHIKLAFE-------NPLSHHFAHNDLLL-AEDATAFSHSFLLGGAVLRHNT 259

Query: 325 SCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKV 384
           S  L GE S     S+A+    +  D+ T + H      SR + K I +      + G +
Sbjct: 260 STQLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLI 319

Query: 385 SVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQ 444
           +V + A  +      ++LL+G      T P +E         H AT  +I DE +FY   
Sbjct: 320 NVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRS 379

Query: 445 RGIPEEAAIALIVNGFVREVLQKLPME------FAVEAQKLIDISLEGS 487
           RGI ++ A  +I+  F  E+ + L  E       A   Q+L   + EG 
Sbjct: 380 RGINQQDAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPGGAREGG 428


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target489 cysteine desulfurase activator complex subunit SufB [Ca
1vh4_A_435 SUFD protein; structural genomics, protein binding 100.0
1vh4_A_435 SUFD protein; structural genomics, protein binding 98.52
>1vh4_A (A:) SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=667.03  Aligned_cols=415  Identities=16%  Similarity=0.139  Sum_probs=351.6

Q ss_pred             ECCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCHHHH
Q ss_conf             20488889999999986329988999999999999996887786658766568200031005653334332101587888
Q gi|254781059|r   30 DKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELL  109 (489)
Q Consensus        30 ~~~~~gl~~~~i~~iS~~k~EP~Wl~e~R~~Al~~f~~l~~P~W~~~~l~~i~~~~i~~~~~p~~~~~~~sld~v~~ei~  109 (489)
                      .++.++|++.+++.||+.++||+||+++|++||+.|+++|+|+|+.+.|+.+++.   .+..+       ++...++...
T Consensus         3 ~~~~~~l~~~~~~~~s~~~~ep~wl~~~R~~a~~~~~~l~~P~~~~e~wryt~~~---~~~~~-------~~~~~~~~~~   72 (435)
T 1vh4_A            3 MAGLPNSSNALQQWHHLFEAEGTKRSPQAQQHLQQLLRTGLPTRKHENWKYTPLE---GLINS-------QFVSIAGEIS   72 (435)
T ss_dssp             --------CHHHHHHHHHHC---CCCHHHHHHHHHHHHHCCCCTTSTTCTTCCCH---HHHTS-------CEECCCCCCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHH---HHHCC-------CCCCCCCCCC
T ss_conf             4558887699999999986227747599999999999829789987081379879---97454-------7765577668


Q ss_pred             HHHHHCCCCHHHHHHHCCCCCCCCEEEEEECCEEEECCCHHHHHHCCEEEEEHHHHHHHHHHHHHHHCCCEECCCCCHHH
Q ss_conf             87765176511111102344443100012135022020056787479088558998777789886202211245653146
Q gi|254781059|r  110 RTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA  189 (489)
Q Consensus       110 ~tf~kLgip~~e~~~l~g~~~~~v~v~~~~ds~~v~~~l~~~L~~~GVi~~~l~eA~~~~p~lv~~~~~~~~~~~~~~f~  189 (489)
                      ..+....++..+.       ...++++++++...      ..+          .++...++++.+++++..+++.+++|+
T Consensus        73 ~~~~~~~~~~~~~-------~~~~~v~g~~~~~~------~~l----------~~~~~~~~~~~~~~~~~~~~~~~~~~~  129 (435)
T 1vh4_A           73 PQQRDALALTLDS-------VRLVFVDGRYVPAL------SDA----------TEGSGYEVSINDDRQGLPDAIQAEVFL  129 (435)
T ss_dssp             HHHHHHHCCCCCS-------EEEEEETTEECGGG------SCC----------CTTSSCEEEEESCCTTCCCCSSCCHHH
T ss_pred             CHHHHHCCCCCCC-------EEEEEECCEECCCC------CCC----------CCCCCEEEECHHHHHHHHHHHHHHHHH
T ss_conf             0021000134676-------05997788881201------567----------556760762377775305444225789


Q ss_pred             HHHHHHHCCCEEEEECCCCCCCCCEEEEEEEC----CCCCEECCEEEEEEECCCEEEEEECCCCCCCCCCCCCCEEEEEE
Q ss_conf             68876423843887347741342127999965----88840022148997277249999615676544444433058998
Q gi|254781059|r  190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRIN----EKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELV  265 (489)
Q Consensus       190 aLn~A~~~~G~fi~Vp~gv~v~~PI~~~~~~~----~~~~~~f~r~lIi~ee~S~v~~iE~~~s~~~~~~~~~~~v~Ei~  265 (489)
                      +||.|++++|+|||||+|+++++||+++|...    .....+++|++|++|+||+++++|+|.++. ...++|++++|++
T Consensus       130 aln~a~~~~g~~i~v~~~~~~~~Pi~i~~~~~~~~~~~~~~~~~~~~i~~~~~s~~~iie~~~~~~-~~~~~~~~~~ei~  208 (435)
T 1vh4_A          130 HLTESLAQSVTHIAVKRGQRPAKPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLN-DARHFTGARFTIN  208 (435)
T ss_dssp             HHHHHHCSCEEEEEECTTCCCSSCEEEEEEECCCSSSCEEEEEEEEEEEECTTCEEEEEEEEEESS-SSCEEEEEEEEEE
T ss_pred             HHHHHHCCCCCEECCCCCEEECCCCEEEEEECCCCCCCCCCEEEEEEEEECCCCHHHHHHHHCCCC-CHHHHCCCEEEEE
T ss_conf             987623023320101452475045303675036454444420157899742530345555421221-0010004216898


Q ss_pred             ECCCCEEEEEEEEECCCCCCCCCCCEEEEEEEEEEEECCCEEEEEEEEEECCCEEEEEEEEEEECCCCEEEEEEEEEECC
Q ss_conf             66995899999630475531144874640146786304630389988751463478853899827872799998776259
Q gi|254781059|r  266 ALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNG  345 (489)
Q Consensus       266 vg~nA~v~~~~iQn~~~~~~~~~~~~~~~~t~r~~~~~~~a~~~~~~~~lG~~~~r~~~~~~L~G~~a~~~~~gi~l~~~  345 (489)
                      +++||+|+|+.+|+|..       +.+++.+.++.+ +++|+++|+.+.+|++++|.++.+.|.|++|+++++|++++.+
T Consensus       209 ~~~~A~l~~~~i~~~~~-------~~~~~~~~~~~~-~~~a~~~~~~~~~g~~~~~~~~~~~l~g~~a~~~~~g~~~~~~  280 (435)
T 1vh4_A          209 VAANAHLQHIKLAFENP-------LSHHFAHNDLLL-AEDATAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMPVK  280 (435)
T ss_dssp             ECTTCEEEEEEEECCCT-------TCEEEEEEEEEE-CTTCEEEEEEEECCCSEEEEEEEEEECSTTCEEEEEEEECCCT
T ss_pred             ECCCCEEEEHHHHHCCC-------CCCCCCHHHHHH-CCCCCEEEEEECCCCCEEEEECCCCCCCCHHHEEEEECCCCCC
T ss_conf             41443343001343034-------432120222102-3565238986415651111001111440011100110245663


Q ss_pred             CEEEEEEEEEEEECCCCCCEEEEEEEECCCCEEEEEEEEEECCCCCCCCCEEEEEEEEECCCCEEEEEEEEEEECCCCEE
Q ss_conf             86899721899836766110100001058946899401473388658743022105884598548622368983487568
Q gi|254781059|r  346 FQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL  425 (489)
Q Consensus       346 ~Q~~D~~~~v~H~~p~t~S~~~~K~i~~d~s~~~f~G~i~v~~~A~~t~~~~~~~~LlLs~~a~~~s~P~LeI~~ddv~~  425 (489)
                      +|++|+++.|+|.||+|+|++++|||+.|+|+++|+|+|+|.++|++|+|+|.|++||||++|+++|+|.|||++|||+|
T Consensus       281 ~q~~d~~~~v~h~~~~t~s~~~~k~vl~d~s~~vf~G~i~i~~~A~~s~a~q~~~~LlLs~~A~~~s~P~LeI~~dDV~~  360 (435)
T 1vh4_A          281 NEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKC  360 (435)
T ss_dssp             TCEEEEEEEEEECSSSCEEEEEEEEEECTTCEEEEEEEEEECTTCTTEEEEEEEEEEECSTTCEEEEEEEEEECCSSEEE
T ss_pred             CHHHHHHHHHHCCCCCCCCEEHHCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHEEEECCCCEEEECCEEEEECCCEEE
T ss_conf             03645432220155532220021033336862698544033666316676765540650588416656238996397269


Q ss_pred             EEEEEECCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHH-HHHHHHHHHCC
Q ss_conf             87532024799999999837889899999999998999988589689999-99999987013
Q gi|254781059|r  426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE-AQKLIDISLEG  486 (489)
Q Consensus       426 ~H~Atvg~id~e~LFYL~sRGi~~~~A~~liv~gF~~~v~~~ip~e~~~e-~~~li~~~~e~  486 (489)
                      +||||||+||+|||||||||||++++|++|||.||+.+++++||.|..++ +...|+.+|.+
T Consensus       361 sHgAtvG~id~e~LFYL~SRGi~~~~A~~Llv~gF~~~vl~~i~~e~lr~~i~~~i~~~l~~  422 (435)
T 1vh4_A          361 SHGATVGRIDDEQIFYLRSRGINQQDAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPG  422 (435)
T ss_dssp             EEEEEEECCCHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHTTSTT
T ss_pred             EEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHC
T ss_conf             94021467898999999876999999999999998999998698599999999999986114



>1vh4_A (A:) SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} Back     alignment and structure