254781060

ABC transporter, nucleotide binding/ATPase protein

GeneID in NCBI database:	8210083	Locus tag:	CLIBASIA_04810
Protein GI in NCBI database:	254781060	Protein Accession:	YP_003065473.1
Gene range:	+(1064211, 1064960)	Protein Length:	249aa
Gene description:	ABC transporter, nucleotide binding/ATPase protein
COG prediction:	[O] ABC-type transport system involved in Fe-S cluster assembly, ATPase component
KEGG prediction:	ABC transporter, nucleotide binding/ATPase protein; K09013 Fe-S cluster assembly ATP-binding protein
SEED prediction:	Iron-sulfur cluster assembly ATPase protein SufC
Pathway involved in KEGG:	not defined
Subsystem involved in SEED:	Fe-S cluster assembly
sequence	sequence profile

Prediction of Local Sequence Properties

Source	Summary	Result

	scaler
NCBI Database	sequence
PSIPRED	secondary structure
SSPRO	secondary structure
DISEMBL	coil and loop
DISEMBL	flexible loop
SEG	low complexity
DISOPRED	disordered
DISEMBL	missing residues
DISPRO	disordered
TMHMM	none TM-Helix
TOPPRED	1 TM-Helix
HMMTOP	1 TM-Helix
MEMSAT	none TM-Helix
MEMSAT_SVM	none TM-Helix
PHOBIUS	none TM-Helix
SignalP_HMM	no
SignalP_NN	no
COILS	coiled coil

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25

MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGYAELIKE

cEEEEEEEEEEccccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEEEccEEcccccHHHHHHcccEEEcccccccccccHHHHHHHHHHHccccccHHHHcHHHHHHHHHHHHHHccccHHHHcccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHcc

cEEEEEEEEEccccccccEEEEEEEEccccEEEEEccccccHHHHHHHHccHHcccccccEEEEccccHHHccHHHHHHHHccccccccEEccHHHHHHHHHHccccccccccHHHHHHHHHHHcHHHHHHHcccccccEEcccccEccccHHHHHHHHHHHHHcccEEEEcHHHHHHcHHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEEcccEEEEEEccEEEEEccHHHHHHccccHHHHHHcc

MLEIKNLRAKIVDTDTEIirglnlkvepsevvaimgpngsgksTLSYLLSghkdyeitagdilykgesiLDWSIVERASKGiflafqypveipgiIMMQFLKIALNEQRKARnekellipdFTRKVRKITAELGINMDMlkrplnlgfsggeKKIAEILQMRLlepslcildetdsgldiDALKIAAQGVNALRSQDRSFLIITHYQRLLnyikpdtihvlhngkiiktgdySIALDLEENGYAELIKE

mleiknlrakivdtdteiirglnlkvepsevvAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKArnekellipdftrkVRKITAelginmdmlkRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGYAELIKE

MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNE**********LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEENGYA*LI**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

Identity	Alignment graph	Length	Definition	E-value
Target		249	ABC transporter, nucleotide binding/ATPase protein [Can
254780744		262	ABC transporter nucleotide binding/ATPase protein	1e-12
254780576		597	ABC transporter related protein [Candidatus Liberi	8e-11
254780917		596	ABC transporter, nucleotide binding/ATPase protein	5e-10
254780596		438	ABC transporter nucleotide binding/ATPase protein	1e-08
254780718		240	putative high-affinity zinc uptake system ATP-bind	9e-08
254780704		254	ABC transporter, nucleotide binding/ATPase protein	3e-07
254780193		528	lipid A ABC exporter family, fused ATPase and inne	1e-05
254781123		610	putative ABC transporter, ATP-binding protein [Can	5e-05
254781123		610	putative ABC transporter, ATP-binding protein [Can	1e-04
254780273		539	putative ABC transporter ATP-binding protein [Cand	1e-04
254780273		539	putative ABC transporter ATP-binding protein [Cand	3e-04
254780559		234	thiamine transporter ATP-binding subunit [Candidat	4e-04
254780173		257	ABC transporter related protein [Candidatus Liberi	0.001
254780567		246	hypothetical protein CLIBASIA_02270 [Candidatus Li	0.010
254780340		348	proline/glycine betaine ABC transporter, ATP-bindi	0.010
254780538		280	ABC transporter, nucleotide binding/ATPase protein	0.025
254780871		227	lipoprotein-releasing system ATP-binding protein l	0.042

>gi\|254780744\|ref\|YP_003065157.1\| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262	Back alignment

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 105/219 (47%), Gaps = 24/219 (10%)

Query: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVER 77
           +++G++L V+P E+V ++GPNG+GK+T  Y+++G    +  +G I   G  I    +  R
Sbjct: 40  VVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICAD--SGSIKIDGNDITKMPMYRR 97

Query: 78  ASKGIFLAFQYPVEIPGIIMMQFLKIAL---NEQRKARNEK-ELLIPDFT-RKVRKITAE 132
           A  GI    Q      G+ + + +   L    + +K R+EK + L+ +F   K R + A 
Sbjct: 98  ARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAP 157

Query: 133 LGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNA 192
           L               SGG+++  EI +  +  PS  +LDE  +G+D  A+      +  
Sbjct: 158 L--------------LSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203

Query: 193 LRSQDRSFLIITH-YQRLLNYIKPDTIHVLHNGKIIKTG 230
           L S+    LI  H    +L  I  D  +++H G ++  G
Sbjct: 204 LASRGIGILITDHNVHEILTLI--DRAYIIHAGGVLAHG 240

>gi\|254780576\|ref\|YP_003064989.1\| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597	Back alignment

 Score = 58.9 bits (141), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 101/218 (46%), Gaps = 17/218 (7%)

Query: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVE- 76
           I +G++ ++ PS+  A++G +G GKST++ LL  ++ Y+I  G I   G+ I   +    
Sbjct: 372 IFKGISFEIAPSKKTALIGESGVGKSTVAKLL--YRLYDIKGGIITIDGQDIKKITKESL 429

Query: 77  RASKGIFLAFQYPVEIP--GIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELG 134
           R + GI         IP   I+    L+  +       +++EL       +++    +L 
Sbjct: 430 RQTIGI---------IPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLP 480

Query: 135 INMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALR 194
              D +     L  SGGEK+   I +  L  P + I DE  S LDI   +   Q   A  
Sbjct: 481 NGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITER-HIQTALATL 539

Query: 195 SQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDY 232
           S++R+ L+I H  RL      D I V   G ++++G +
Sbjct: 540 SKNRTTLVIAH--RLSTITDADNIIVFDQGTVVESGSH 575

>gi\|254780917\|ref\|YP_003065330.1\| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596	Back alignment

 Score = 56.2 bits (134), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 110/225 (48%), Gaps = 33/225 (14%)

Query: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILD---WSI 74
           ++ G+NL  +  ++ A++GP+GSGKST+  LL   + Y+ ++G I   G +I D    S+
Sbjct: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLL--MRMYDPSSGSIEIDGINIRDITFSSL 425

Query: 75  VERAS---KGIFL---AFQYPVEI--PGIIMMQFLKIALNEQRKARNEKELLIPDFTRKV 126
            ER S   + +FL     +Y + I  P     + ++IA     K+ N  + ++    +  
Sbjct: 426 RERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIA-----KSANAHDFIM-SLPQGY 479

Query: 127 RKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIA 186
                E G N+           SGG+K+   I +  L +  + +LDE  S LD     + 
Sbjct: 480 DTYVGENGSNL-----------SGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLV 528

Query: 187 AQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGD 231
            Q ++ L  Q R+ ++I H  R+   I+ D I  + +GK+ ++GD
Sbjct: 529 RQALSRLM-QGRTTIVIAH--RISTIIEADHIIFIEDGKVSESGD 570

>gi\|254780596\|ref\|YP_003065009.1\| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438	Back alignment

 Score = 51.6 bits (122), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 79/163 (48%), Gaps = 17/163 (10%)

Query: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVER 77
           ++  +N  V   E+V ++G +GSGKSTL  +++G      ++G +L+KG+ I D      
Sbjct: 32  VLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGL--VSPSSGQVLFKGKKIKD------ 83

Query: 78  ASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINM 137
             K I + FQ     P + +++ +++ L  +   + E         R+ R ++A   I +
Sbjct: 84  PPKDISVVFQTFALFPWLTVLENVELGLKAKGIDKEE---------RRKRALSAIDLIGL 134

Query: 138 DMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           D  +       SGG  +     +  ++ PSL ++DE  S LD+
Sbjct: 135 DGFESAHTTEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDV 177

>gi\|254780718\|ref\|YP_003065131.1\| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240	Back alignment

 Score = 48.9 bits (115), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 100/211 (47%), Gaps = 36/211 (17%)

Query: 17  EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVE 76
           +I++ +N  ++P+E+V ++GPNGSGKST++ L++G    + T G +    + I+ +    
Sbjct: 24  KILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITG--IIKPTIGSVKRHPQLIVGY---- 77

Query: 77  RASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNE---KELLIPDFTRKVRKITAEL 133
              + + +    P+      +M+F+ +++   R    +   +  LI  + R ++ +    
Sbjct: 78  -VPQKVTIENTLPLS-----LMRFMTLSMPSSRDDVLQILDRVNLIGKYNRNIKDL---- 127

Query: 134 GINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNAL 193
                          SGGE + A + +  L +P+L +LDE   G+D        + + ++
Sbjct: 128 ---------------SGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELITSV 172

Query: 194 R-SQDRSFLIITHYQRLLNYIKPDTIHVLHN 223
           R S     L+I+H   ++     DT+  L+N
Sbjct: 173 RQSTGCGILLISHNLHMV-MASTDTVICLNN 202

>gi\|254780704\|ref\|YP_003065117.1\| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254	Back alignment

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 84/188 (44%), Gaps = 9/188 (4%)

Query: 22  LNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHK---DYEITAGDILYKGESILDWSI-VER 77
           +NLK+  + V A++GP+G GKST    L+      D  +  G+I+  G++I   S+ V R
Sbjct: 25  INLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEIILDGKNIYQSSVDVVR 84

Query: 78  ASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINM 137
               + + FQ P   P  I   +  +A   +       +  I        K  +      
Sbjct: 85  LRARVGMVFQRPNPFPKSI---YDNVAYGPRIHGLGNNKADIDQIVEMSLKKASLFNEVK 141

Query: 138 DMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQD 197
           D L    +L  SGG+++   I +   + P + ++DE  S LD  A     + ++ LR + 
Sbjct: 142 DRLFHDASL-LSGGQQQRVCIARALAVNPEVILMDEPCSALDPIATASVEELIHELR-ES 199

Query: 198 RSFLIITH 205
            + +I+TH
Sbjct: 200 LTIVIVTH 207

>gi\|254780193\|ref\|YP_003064606.1\| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528	Back alignment

 Score = 41.6 bits (96), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 97/216 (44%), Gaps = 15/216 (6%)

Query: 17  EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVE 76
            I++ +N  V+P E +A++G +G+GK+++  L+   + Y+  +G +  +G   +D  ++ 
Sbjct: 304 SILKNVNFTVQPGETIALVGDSGAGKTSIFSLIL--RFYDPCSGSVEIEG---IDLRLLS 358

Query: 77  RASKGIFLAF--QYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELG 134
                 F+A+  Q+P+ I   +   +  IA+      R  KE+       +  +    L 
Sbjct: 359 LEEIRRFIAWVPQHPIMIAASV---YDNIAIGCPHATR--KEIQNAAMLAQAHEFIGCLE 413

Query: 135 INMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALR 194
              D +     +  S G+ +   I +  L +  + +LDE  S LDI+  +   +    LR
Sbjct: 414 NGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQ---KIWKVLR 470

Query: 195 SQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTG 230
            Q R    I    RL      D + VLH+  I++ G
Sbjct: 471 EQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKG 506

>gi\|254781123\|ref\|YP_003065536.1\| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610	Back alignment

 Score = 39.7 bits (91), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 81/209 (38%), Gaps = 46/209 (22%)

Query: 17  EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESIL------ 70
           ++++ + L ++P E + ++G NGSGKSTL  + +G    E  +G++     S L      
Sbjct: 19  DLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGIT--EPQSGNVFLHSSSRLGYLEQN 76

Query: 71  -DWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKI 129
            D S     S+ I    +  +E P        K  L EQ +  N                
Sbjct: 77  PDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIEN---------------- 120

Query: 130 TAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQG 189
                              S G+ +   +++M +  P + ILDE  + LD   +    Q 
Sbjct: 121 ------------------LSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQE 162

Query: 190 VNALRSQDRSFLIITHYQRLLNYIKPDTI 218
           +  + S   + + ++H +R L  +   T+
Sbjct: 163 LLKINS---ALIFVSHDRRFLETLSTTTV 188

>gi\|254781123\|ref\|YP_003065536.1\| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610	Back alignment

 Score = 38.5 bits (88), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 26/37 (70%)

Query: 15  DTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSG 51
           D  +++  +L++   E + I+GPNG+GK+TL  LL+G
Sbjct: 296 DRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTG 332

>gi\|254780273\|ref\|YP_003064686.1\| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539	Back alignment

 Score = 38.1 bits (87), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 14  TDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSG 51
            D  +I  L+ K+ P  +V ++GPNG+GK+TL  +L+G
Sbjct: 328 NDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTG 365

>gi\|254780273\|ref\|YP_003064686.1\| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539	Back alignment

 Score = 37.0 bits (84), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 114/248 (45%), Gaps = 27/248 (10%)

Query: 17  EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSG-HKDYE--------ITAGDILYKGE 67
           +++  +NL   P   + I+GPNG+GKST+  +++G  K+Y          T G +  + +
Sbjct: 20  KVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQ 79

Query: 68  SILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELL--IPDFTRK 125
             L  ++ E   +G        V     I+ ++ ++ +N   K   E   L  I D ++ 
Sbjct: 80  LDLSKTVKENIIEG--------VAHKQAILDRYNELMMNYSEKTEEEIAKLQDIID-SKG 130

Query: 126 VRKITAELGINMDMLKRP---LNL-GFSGGEKKIAEILQMRLLEPSLCILDETDSGLDID 181
           +  +  E+ + ++ L  P   LN+   SGGEK+   + ++ L  P L +LDE  + LD +
Sbjct: 131 LWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAE 190

Query: 182 ALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEEN 241
            +   A     LR    + L++TH +  L+ +    + V     I   G+YS  L ++  
Sbjct: 191 TI---AWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNYSAYLQMKAK 247

Query: 242 GYAELIKE 249
             A+  +E
Sbjct: 248 RMAQENRE 255

>gi\|254780559\|ref\|YP_003064972.1\| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234	Back alignment

 Score = 36.6 bits (83), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 22 LNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGES 68
           + +V  +E + I+GP+G+GKSTL  L++G K Y  T G I   G++
Sbjct: 18 FDFQVNKAERIVILGPSGAGKSTLLSLMAGFK-YP-TRGSIFLNGQN 62

>gi\|254780173\|ref\|YP_003064586.1\| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257	Back alignment

 Score = 34.7 bits (78), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 19 IRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKG 66
          +R +NL V   E V I GP+GSGKSTL   ++  + ++  AG+I+  G
Sbjct: 33 LRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQ--AGEIIING 78

>gi\|254780567\|ref\|YP_003064980.1\| hypothetical protein CLIBASIA_02270 [Candidatus Liberibacter asiaticus str. psy62] Length = 246	Back alignment

 Score = 32.0 bits (71), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 28 PSEVVAIMGPNGSGKSTLSYLLS 50
          PS VV ++GP+GSGKS L+ + S
Sbjct: 63 PSRVVILVGPSGSGKSCLANIWS 85

>gi\|254780340\|ref\|YP_003064753.1\| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348	Back alignment

 Score = 32.0 bits (71), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 101/227 (44%), Gaps = 42/227 (18%)

Query: 23  NLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDIL------YKGESILDWSIVE 76
           NL+V+  E++ +MG +G+GKSTL   ++G     +  G++L      +      D +++ 
Sbjct: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLA--PVVRGEVLVDTDKGFVNPYAADANVLR 106

Query: 77  RAS-KGIFLAFQYPVEIPGIIM-------MQFLKIALNEQRKARNEKELLIPDFTRKVRK 128
           +     + + FQ    +P   +       ++FL I  + +RK+R  + L I + T+    
Sbjct: 107 KLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIP-DVERKSRVAEHLEIVNLTK---- 161

Query: 129 ITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD-IDALKIAA 187
             A+  INM           SGG K+     +       + ++DE  S LD +  +++  
Sbjct: 162 -WADCKINM----------LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQD 210

Query: 188 QGVNALRSQDRSFLIITH----YQRLLNYIKPDTIHVLHNGKIIKTG 230
           + +   R   ++ + ++H      RL N I      ++  G+II+ G
Sbjct: 211 ELLALQRKLKKTIVFVSHDINEAFRLGNRIA-----IMEGGRIIQCG 252

>gi\|254780538\|ref\|YP_003064951.1\| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280	Back alignment

 Score = 30.8 bits (68), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 88/194 (45%), Gaps = 29/194 (14%)

Query: 22  LNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDI-LYKGESILDWSIVERASK 80
           +NL +  + + A++G NG+GKSTL         ++   G I L KG   +    VE A K
Sbjct: 31  VNLFIPENTITALIGLNGAGKSTL---------FQAIMGLIPLDKGSISIFNQTVENALK 81

Query: 81  GIFLAF---------QYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITA 131
              +A+          +P+ +  ++MM   K  +N +R A N       D+ R V +   
Sbjct: 82  ADLIAYIPQTESIDWTFPILVEDVVMMGRYK-HMNWRRVASNN------DY-RIVTEALE 133

Query: 132 ELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVN 191
            +G++  M +R +    S G++K   + +    +  + I+DE  + +D    +     + 
Sbjct: 134 NVGMS-SMRQRQIG-ELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLK 191

Query: 192 ALRSQDRSFLIITH 205
           +L ++D   L+ TH
Sbjct: 192 SLLNEDIMILVSTH 205

>gi\|254780871\|ref\|YP_003065284.1\| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227	Back alignment

 Score = 30.0 bits (66), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 24/31 (77%)

Query: 18 IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYL 48
          ++  ++L ++  E+VA++ P+G+GKST+ ++
Sbjct: 25 VLENVHLSLKKGEIVALVSPSGTGKSTILHI 55

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

Identity	Alignment graph	Length	Definition	Round	E-value
Target		249	ABC transporter, nucleotide binding/ATPase protein [Can
315122395		258	ABC transporter, nucleotide binding/ATPase protein [Can	1	1e-122
325293225		251	FeS assembly ATPase SufC [Agrobacterium sp. H13-3] Leng	1	1e-103
15889126		251	ABC transporter, nucleotide binding/ATPase protein [Agr	1	1e-102
254704236		251	FeS assembly ATPase SufC [Brucella suis bv. 3 str. 686]	1	1e-102
222148790		251	ABC transporter nucleotide binding/ATPase protein [Agro	1	1e-102
153009584		251	FeS assembly ATPase SufC [Ochrobactrum anthropi ATCC 49	1	1e-102
239831806		251	FeS assembly ATPase SufC [Ochrobactrum intermedium LMG	1	1e-101
23501816		251	ABC transporter ATP-binding protein [Brucella suis 1330	1	1e-101
148559564		280	FeS assembly ATPase SufC [Brucella ovis ATCC 25840] Len	1	1e-101
62289873		251	ABC transporter ATP-binding protein [Brucella abortus b	1	1e-101

>gi\|315122395\|ref\|YP_004062884.1\| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 258	Back alignment and organism information

 Score =  441 bits (1133), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 209/249 (83%), Positives = 235/249 (94%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M EI NL AKI++TDTEIIRGLNLKV+P EVVAIMGPNGSGKSTL+Y++SGHK YE+TAG
Sbjct: 1   MFEIINLHAKIIETDTEIIRGLNLKVDPGEVVAIMGPNGSGKSTLAYVVSGHKSYEVTAG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           DILYKGESILDWSI ERASKGIFLAFQYPVEIPGI+ MQFLK ALNEQRKARNE+++L+P
Sbjct: 61  DILYKGESILDWSISERASKGIFLAFQYPVEIPGIVTMQFLKSALNEQRKARNEEDILVP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF RKVRKI  +LGINMDMLKRPLNLGFSGGEKKI+EILQM LLEPSLCILDETDSGLDI
Sbjct: 121 DFIRKVRKIAGDLGINMDMLKRPLNLGFSGGEKKISEILQMHLLEPSLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALK+AAQGVN+LRSQ+RSFLIITHYQRLL+YIKPDT+HVL++G+I+KTGD+SI LDLE 
Sbjct: 181 DALKVAAQGVNSLRSQNRSFLIITHYQRLLDYIKPDTVHVLYDGRIVKTGDFSIVLDLEM 240

Query: 241 NGYAELIKE 249
           NGYA+LI+E
Sbjct: 241 NGYAKLIEE 249

Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

>gi\|325293225\|ref\|YP_004279089.1\| FeS assembly ATPase SufC [Agrobacterium sp. H13-3] Length = 251	Back alignment and organism information

>gi\|15889126\|ref\|NP_354807.1\| ABC transporter, nucleotide binding/ATPase protein [Agrobacterium tumefaciens str. C58] Length = 251	Back alignment and organism information

>gi\|254704236\|ref\|ZP_05166064.1\| FeS assembly ATPase SufC [Brucella suis bv. 3 str. 686] Length = 251	Back alignment and organism information

>gi\|222148790\|ref\|YP_002549747.1\| ABC transporter nucleotide binding/ATPase protein [Agrobacterium vitis S4] Length = 251	Back alignment and organism information

>gi\|153009584\|ref\|YP_001370799.1\| FeS assembly ATPase SufC [Ochrobactrum anthropi ATCC 49188] Length = 251	Back alignment and organism information

>gi\|239831806\|ref\|ZP_04680135.1\| FeS assembly ATPase SufC [Ochrobactrum intermedium LMG 3301] Length = 251	Back alignment and organism information

>gi\|23501816\|ref\|NP_697943.1\| ABC transporter ATP-binding protein [Brucella suis 1330] Length = 251	Back alignment and organism information

>gi\|148559564\|ref\|YP_001258905.1\| FeS assembly ATPase SufC [Brucella ovis ATCC 25840] Length = 280	Back alignment and organism information

>gi\|62289873\|ref\|YP_221666.1\| ABC transporter ATP-binding protein [Brucella abortus bv. 1 str. 9-941] Length = 251	Back alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

Identity	Alignment graph	Length	Definition	E-value
Target		249	ABC transporter, nucleotide binding/ATPase protein [Can
TIGR01978		243	TIGR01978, sufC, FeS assembly ATPase SufC	6e-94
PRK09580		248	PRK09580, sufC, cysteine desulfurase ATPase component;	4e-85
CHL00131		252	CHL00131, ycf16, sulfate ABC transporter protein; Valid	2e-84
cd03217		200	cd03217, ABC_FeS_Assembly, ABC-type transport system in	5e-70
cd03225		211	cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c	4e-24
cd03219		236	cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC	5e-24
COG1131		293	COG1131, CcmA, ABC-type multidrug transport system, ATP	9e-22
KOG0055		1228	KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter	8e-21
COG1123		539	COG1123, COG1123, ATPase components of various ABC-type	2e-20
COG4988		559	COG4988, CydD, ABC-type transport system involved in cy	4e-19
COG1129		500	COG1129, MglA, ABC-type sugar transport system, ATPase	4e-19
COG0444		316	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t	4e-19
COG0411		250	COG0411, LivG, ABC-type branched-chain amino acid trans	5e-19
cd03257		228	cd03257, ABC_NikE_OppD_transporters, The ABC transporte	1e-18
COG1122		235	COG1122, CbiO, ABC-type cobalt transport system, ATPase	1e-18
COG3839		338	COG3839, MalK, ABC-type sugar transport systems, ATPase	1e-18
cd03259		213	cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So	2e-18
KOG0058		716	KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf	6e-18
COG2274		709	COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte	6e-18
cd03254		229	cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP	1e-17
COG1136		226	COG1136, SalX, ABC-type antimicrobial peptide transport	2e-17
COG1120		258	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra	3e-17
cd03249		238	cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB	3e-17
cd03255		218	cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris	4e-17
cd03228		171	cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr	8e-17
cd03218		232	cd03218, ABC_YhbG, The ABC transporters belonging to th	1e-16
COG1126		240	COG1126, GlnQ, ABC-type polar amino acid transport syst	1e-16
COG1124		252	COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t	2e-16
PRK13639		275	PRK13639, cbiO, cobalt transporter ATP-binding subunit;	2e-16
COG3842		352	COG3842, PotA, ABC-type spermidine/putrescine transport	3e-16
cd03224		222	cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par	4e-16
cd03226		205	cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC	4e-16
COG1123		539	COG1123, COG1123, ATPase components of various ABC-type	6e-16
COG3845		501	COG3845, COG3845, ABC-type uncharacterized transport sy	6e-16
cd03245		220	cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc	1e-15
cd03213		194	cd03213, ABCG_EPDR, ABCG transporters are involved in e	1e-15
COG4987		573	COG4987, CydC, ABC-type transport system involved in cy	1e-15
cd03260		227	cd03260, ABC_PstB_phosphate_transporter, Phosphate upta	2e-15
cd03251		234	cd03251, ABCC_MsbA, MsbA is an essential ABC transporte	3e-15
COG1121		254	COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase	4e-15
cd03230		173	cd03230, ABC_DR_subfamily_A, This family of ATP-binding	5e-15
cd03253		236	cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor	7e-15
COG1137		243	COG1137, YhbG, ABC-type (unclassified) transport system	7e-15
KOG0055		1228	KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter	1e-14
cd03263		220	cd03263, ABC_subfamily_A, The ABCA subfamily mediates t	1e-14
TIGR02204		576	TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind	1e-14
TIGR02203		571	TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin	1e-14
cd03301		213	cd03301, ABC_MalK_N, The N-terminal ATPase domain of th	2e-14
COG1116		248	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t	2e-14
COG0488		530	COG0488, Uup, ATPase components of ABC transporters wit	3e-14
KOG0056		790	KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A	4e-14
PRK13632		271	PRK13632, cbiO, cobalt transporter ATP-binding subunit;	4e-14
cd03261		235	cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca	5e-14
KOG0061		613	KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily	1e-13
COG4559		259	COG4559, COG4559, ABC-type hemin transport system, ATPa	1e-13
TIGR02633		500	TIGR02633, xylG, D-xylose ABC transporter, ATP-binding	1e-13
COG1132		567	COG1132, MdlB, ABC-type multidrug transport system, ATP	2e-13
TIGR03375		694	TIGR03375, type_I_sec_LssB, type I secretion system ATP	2e-13
cd03214		180	cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport	3e-13
COG1118		345	COG1118, CysA, ABC-type sulfate/molybdate transport sys	3e-13
PRK14247		250	PRK14247, PRK14247, phosphate ABC transporter ATP-bindi	3e-13
TIGR02211		221	TIGR02211, LolD_lipo_ex, lipoprotein releasing system,	3e-13
PRK03695		248	PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro	4e-13
COG5265		497	COG5265, ATM1, ABC-type transport system involved in Fe	5e-13
TIGR00958		711	TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil	6e-13
COG4172		534	COG4172, COG4172, ABC-type uncharacterized transport sy	1e-12
TIGR02769		265	TIGR02769, nickel_nikE, nickel import ATP-binding prote	1e-12
PRK13644		274	PRK13644, cbiO, cobalt transporter ATP-binding subunit;	1e-12
COG4674		249	COG4674, COG4674, Uncharacterized ABC-type transport sy	2e-12
PRK13657		588	PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor	2e-12
COG0488		530	COG0488, Uup, ATPase components of ABC transporters wit	3e-12
KOG0065		1391	KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance	3e-12
cd03299		235	cd03299, ABC_ModC_like, Archeal protein closely related	3e-12
COG1117		253	COG1117, PstB, ABC-type phosphate transport system, ATP	3e-12
PRK13549		506	PRK13549, PRK13549, xylose transporter ATP-binding subu	3e-12
COG4172		534	COG4172, COG4172, ABC-type uncharacterized transport sy	5e-12
COG1127		263	COG1127, Ttg2A, ABC-type transport system involved in r	5e-12
cd03268		208	cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily	7e-12
COG1101		263	COG1101, PhnK, ABC-type uncharacterized transport syste	8e-12
COG4608		268	COG4608, AppF, ABC-type oligopeptide transport system,	2e-11
cd03266		218	cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c	2e-11
COG1134		249	COG1134, TagH, ABC-type polysaccharide/polyol phosphate	2e-11
COG1135		339	COG1135, AbcC, ABC-type metal ion transport system, ATP	2e-11
TIGR01193		708	TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp	2e-11
COG4618		580	COG4618, ArpD, ABC-type protease/lipase transport syste	3e-11
COG2401		593	COG2401, COG2401, ABC-type ATPase fused to a predicted	3e-11
cd03248		226	cd03248, ABCC_TAP, TAP, the Transporter Associated with	3e-11
cd03265		220	cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp	4e-11
COG4136		213	COG4136, COG4136, ABC-type uncharacterized transport sy	4e-11
TIGR03864		236	TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su	4e-11
cd03300		232	cd03300, ABC_PotA_N, PotA is an ABC-type transporter an	6e-11
cd03298		211	cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami	6e-11
cd03234		226	cd03234, ABCG_White, The White subfamily represents ABC	6e-11
cd03229		178	cd03229, ABC_Class3, This class is comprised of all BPD	8e-11
cd03216		163	cd03216, ABC_Carb_Monos_I, This family represents the d	8e-11
TIGR03411		242	TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b	8e-11
PRK10419		268	PRK10419, nikE, nickel transporter ATP-binding protein	9e-11
cd03247		178	cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat	1e-10
COG4167		267	COG4167, SapF, ABC-type antimicrobial peptide transport	1e-10
PRK13652		277	PRK13652, cbiO, cobalt transporter ATP-binding subunit;	1e-10
PLN03211		659	PLN03211, PLN03211, ABC transporter G-25; Provisional	1e-10
TIGR01846		694	TIGR01846, type_I_sec_HlyB, type I secretion system ABC	1e-10
cd03258		233	cd03258, ABC_MetN_methionine_transporter, MetN (also kn	2e-10
PRK14266		250	PRK14266, PRK14266, phosphate ABC transporter ATP-bindi	2e-10
cd03252		237	cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin	3e-10
COG1119		257	COG1119, ModF, ABC-type molybdenum transport system, AT	3e-10
PRK11300		255	PRK11300, livG, leucine/isoleucine/valine transporter A	3e-10
COG4555		245	COG4555, NatA, ABC-type Na+ transport system, ATPase co	4e-10
COG3638		258	COG3638, COG3638, ABC-type phosphate/phosphonate transp	5e-10
PRK11176		582	PRK11176, PRK11176, lipid transporter ATP-binding/perme	7e-10
KOG0927		614	KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s	8e-10
cd03264		211	cd03264, ABC_drug_resistance_like, ABC-type multidrug t	8e-10
KOG0927		614	KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s	1e-09
cd03256		241	cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp	1e-09
cd03296		239	cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra	1e-09
COG4598		256	COG4598, HisP, ABC-type histidine transport system, ATP	2e-09
KOG0057		591	KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e	2e-09
PRK10790		592	PRK10790, PRK10790, putative multidrug transporter memb	2e-09
PRK14267		253	PRK14267, PRK14267, phosphate ABC transporter ATP-bindi	3e-09
TIGR01192		585	TIGR01192, chvA, glucan exporter ATP-binding protein	3e-09
TIGR01842		544	TIGR01842, type_I_sec_PrtD, type I secretion system ABC	4e-09
COG3840		231	COG3840, ThiQ, ABC-type thiamine transport system, ATPa	6e-09
PRK14248		268	PRK14248, PRK14248, phosphate ABC transporter ATP-bindi	6e-09
cd03220		224	cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr	7e-09
TIGR01277		213	TIGR01277, thiQ, thiamine ABC transporter, ATP-binding	7e-09
PRK10938		490	PRK10938, PRK10938, putative molybdenum transport ATP-b	8e-09
COG3845		501	COG3845, COG3845, ABC-type uncharacterized transport sy	1e-08
COG4138		248	COG4138, BtuD, ABC-type cobalamin transport system, ATP	1e-08
cd03297		214	cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB	1e-08
PRK14262		250	PRK14262, PRK14262, phosphate ABC transporter ATP-bindi	1e-08
PRK13635		279	PRK13635, cbiO, cobalt transporter ATP-binding subunit;	1e-08
cd03244		221	cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil	2e-08
KOG0062		582	KOG0062, KOG0062, KOG0062, ATPase component of ABC tran	2e-08
cd03215		182	cd03215, ABC_Carb_Monos_II, This family represents doma	2e-08
PRK14246		257	PRK14246, PRK14246, phosphate ABC transporter ATP-bindi	2e-08
cd03269		210	cd03269, ABC_putative_ATPase, This subfamily is involve	3e-08
TIGR01188		302	TIGR01188, drrA, daunorubicin resistance ABC transporte	3e-08
PRK15439		510	PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b	3e-08
TIGR03258		362	TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport	3e-08
PRK13647		274	PRK13647, cbiO, cobalt transporter ATP-binding subunit;	6e-08
PRK15134		529	PRK15134, PRK15134, microcin C ABC transporter ATP-bind	8e-08
PRK14251		251	PRK14251, PRK14251, phosphate ABC transporter ATP-bindi	9e-08
cd03233		202	cd03233, ABC_PDR_domain1, The pleiotropic drug resistan	1e-07
PRK10789		569	PRK10789, PRK10789, putative multidrug transporter memb	1e-07
PRK14242		253	PRK14242, PRK14242, phosphate transporter ATP-binding p	1e-07
COG4586		325	COG4586, COG4586, ABC-type uncharacterized transport sy	2e-07
PRK13649		280	PRK13649, cbiO, cobalt transporter ATP-binding subunit;	2e-07
PRK15079		331	PRK15079, PRK15079, oligopeptide ABC transporter ATP-bi	2e-07
TIGR02770		230	TIGR02770, nickel_nikD, nickel import ATP-binding prote	2e-07
PRK14240		250	PRK14240, PRK14240, phosphate transporter ATP-binding p	2e-07
PRK13638		271	PRK13638, cbiO, cobalt transporter ATP-binding subunit;	2e-07
PRK09700		510	PRK09700, PRK09700, D-allose transporter ATP-binding pr	2e-07
TIGR01186		363	TIGR01186, proV, glycine betaine/L-proline transport AT	4e-07
TIGR00968		237	TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind	4e-07
PRK13536		340	PRK13536, PRK13536, nodulation factor exporter subunit	4e-07
PRK13642		277	PRK13642, cbiO, cobalt transporter ATP-binding subunit;	4e-07
cd03292		214	cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu	5e-07
PRK14271		276	PRK14271, PRK14271, phosphate ABC transporter ATP-bindi	5e-07
PRK13631		320	PRK13631, cbiO, cobalt transporter ATP-binding subunit;	5e-07
PRK13633		280	PRK13633, PRK13633, cobalt transporter ATP-binding subu	5e-07
PRK13640		282	PRK13640, cbiO, cobalt transporter ATP-binding subunit;	6e-07
KOG0054		1381	KOG0054, KOG0054, KOG0054, Multidrug resistance-associa	7e-07
COG4148		352	COG4148, ModC, ABC-type molybdate transport system, ATP	7e-07
COG1129		500	COG1129, MglA, ABC-type sugar transport system, ATPase	9e-07
KOG0062		582	KOG0062, KOG0062, KOG0062, ATPase component of ABC tran	1e-06
COG2884		223	COG2884, FtsE, Predicted ATPase involved in cell divisi	1e-06
cd03294		269	cd03294, ABC_Pro_Gly_Bertaine, This family comprises th	1e-06
COG4604		252	COG4604, CeuD, ABC-type enterochelin transport system,	1e-06
PRK13537		306	PRK13537, PRK13537, nodulation ABC transporter NodI; Pr	1e-06
PRK14239		252	PRK14239, PRK14239, phosphate transporter ATP-binding p	1e-06
PRK14257		329	PRK14257, PRK14257, phosphate ABC transporter ATP-bindi	1e-06
PRK11308		327	PRK11308, dppF, dipeptide transporter ATP-binding subun	2e-06
TIGR03873		256	TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor	2e-06
PRK13651		305	PRK13651, PRK13651, cobalt transporter ATP-binding subu	2e-06
PRK15112		267	PRK15112, PRK15112, antimicrobial peptide ABC system AT	2e-06
TIGR03771		223	TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans	4e-06
PRK10575		265	PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi	4e-06
PRK11288		501	PRK11288, araG, L-arabinose transporter ATP-binding pro	4e-06
PRK09536		402	PRK09536, btuD, corrinoid ABC transporter ATPase; Revie	5e-06
PRK14273		254	PRK14273, PRK14273, phosphate ABC transporter ATP-bindi	6e-06
PRK13650		279	PRK13650, cbiO, cobalt transporter ATP-binding subunit;	6e-06
PRK11022		326	PRK11022, dppD, dipeptide transporter ATP-binding subun	7e-06
TIGR01288		303	TIGR01288, nodI, ATP-binding ABC transporter family nod	9e-06
COG4107		258	COG4107, PhnK, ABC-type phosphonate transport system, A	1e-05
COG4152		300	COG4152, COG4152, ABC-type uncharacterized transport sy	1e-05
TIGR03269		520	TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase	1e-05
PRK11614		237	PRK11614, livF, leucine/isoleucine/valine transporter A	1e-05
cd03236		255	cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai	2e-05
cd03232		192	cd03232, ABC_PDR_domain2, The pleiotropic drug resistan	2e-05
PRK15134		529	PRK15134, PRK15134, microcin C ABC transporter ATP-bind	2e-05
PRK13643		288	PRK13643, cbiO, cobalt transporter ATP-binding subunit;	2e-05
PRK10762		501	PRK10762, PRK10762, D-ribose transporter ATP binding pr	2e-05
PRK10070		400	PRK10070, PRK10070, glycine betaine transporter ATP-bin	2e-05
COG1245		591	COG1245, COG1245, Predicted ATPase, RNase L inhibitor (	3e-05
cd03295		242	cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b	4e-05
TIGR03740		223	TIGR03740, galliderm_ABC, gallidermin-class lantibiotic	4e-05
TIGR03005		252	TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra	4e-05
PRK14244		251	PRK14244, PRK14244, phosphate ABC transporter ATP-bindi	4e-05
cd03369		207	cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M	6e-05
PRK14269		246	PRK14269, PRK14269, phosphate ABC transporter ATP-bindi	6e-05
PLN03232		1495	PLN03232, PLN03232, ABC transporter C family member; Pr	7e-05
TIGR02323		253	TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p	7e-05
PRK14255		252	PRK14255, PRK14255, phosphate ABC transporter ATP-bindi	8e-05
TIGR00956		1394	TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F	9e-05
KOG0054		1381	KOG0054, KOG0054, KOG0054, Multidrug resistance-associa	1e-04
PRK13634		290	PRK13634, cbiO, cobalt transporter ATP-binding subunit;	1e-04
PRK11432		351	PRK11432, fbpC, ferric transporter ATP-binding subunit;	1e-04
COG4161		242	COG4161, ArtP, ABC-type arginine transport system, ATPa	2e-04
PRK10261		623	PRK10261, PRK10261, glutathione transporter ATP-binding	2e-04
PRK10636		638	PRK10636, PRK10636, putative ABC transporter ATP-bindin	2e-04
TIGR02314		343	TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-	2e-04
cd03288		257	cd03288, ABCC_SUR2, The SUR domain 2	3e-04
TIGR03522		301	TIGR03522, GldA_ABC_ATP, gliding motility-associated AB	3e-04
PRK13409		590	PRK13409, PRK13409, putative ATPase RIL; Provisional	3e-04
PRK13641		287	PRK13641, cbiO, cobalt transporter ATP-binding subunit;	7e-04
cd03291		282	cd03291, ABCC_CFTR1, The CFTR subfamily domain 1	8e-04
PRK10418		254	PRK10418, nikD, nickel transporter ATP-binding protein	0.001
cd03250		204	cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil	0.002
PRK13645		289	PRK13645, cbiO, cobalt transporter ATP-binding subunit;	0.002
PLN03130		1622	PLN03130, PLN03130, ABC transporter C family member; Pr	0.002
PRK14264		305	PRK14264, PRK14264, phosphate ABC transporter ATP-bindi	0.002
COG0396		251	COG0396, SufC, ABC-type transport system involved in Fe	2e-90
TIGR01166		190	TIGR01166, cbiO, cobalt transport protein ATP-binding s	2e-16
cd03293		220	cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are	1e-13
cd03235		213	cd03235, ABC_Metallic_Cations, ABC component of the met	2e-13
COG4619		223	COG4619, COG4619, ABC-type uncharacterized transport sy	8e-13
COG0410		237	COG0410, LivF, ABC-type branched-chain amino acid trans	8e-13
cd03262		213	cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the	2e-12
KOG0059		885	KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel	3e-12
PRK11629		233	PRK11629, lolD, lipoprotein transporter ATP-binding sub	5e-12
TIGR02857		529	TIGR02857, CydD, thiol reductant ABC exporter, CydD sub	4e-11
COG4181		228	COG4181, COG4181, Predicted ABC-type transport system i	7e-10
PRK14238		271	PRK14238, PRK14238, phosphate transporter ATP-binding p	8e-10
PRK14245		250	PRK14245, PRK14245, phosphate ABC transporter ATP-bindi	4e-09
PRK11264		250	PRK11264, PRK11264, putative amino-acid ABC transporter	5e-09
TIGR00972		247	TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-	6e-09
PRK14260		259	PRK14260, PRK14260, phosphate ABC transporter ATP-bindi	1e-08
TIGR03608		206	TIGR03608, L_ocin_972_ABC, putative bacteriocin export	2e-08
PRK13637		287	PRK13637, cbiO, cobalt transporter ATP-binding subunit;	3e-08
PRK11000		369	PRK11000, PRK11000, maltose/maltodextrin transporter AT	3e-08
PRK10895		241	PRK10895, PRK10895, lipopolysaccharide ABC transporter	4e-08
PRK13648		269	PRK13648, cbiO, cobalt transporter ATP-binding subunit;	4e-08
cd03267		236	cd03267, ABC_NatA_like, Similar in sequence to NatA, th	5e-08
PRK14250		241	PRK14250, PRK14250, phosphate ABC transporter ATP-bindi	5e-08
COG1125		309	COG1125, OpuBA, ABC-type proline/glycine betaine transp	1e-07
PRK13636		283	PRK13636, cbiO, cobalt transporter ATP-binding subunit;	1e-07
COG4525		259	COG4525, TauB, ABC-type taurine transport system, ATPas	2e-07
PRK14275		286	PRK14275, PRK14275, phosphate ABC transporter ATP-bindi	2e-07
COG4133		209	COG4133, CcmA, ABC-type transport system involved in cy	5e-07
TIGR02142		354	TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi	5e-07
PRK14272		252	PRK14272, PRK14272, phosphate ABC transporter ATP-bindi	8e-07
KOG0065		1391	KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance	1e-06
COG4175		386	COG4175, ProV, ABC-type proline/glycine betaine transpo	1e-06
PRK14253		249	PRK14253, PRK14253, phosphate ABC transporter ATP-bindi	1e-06
TIGR02868		529	TIGR02868, CydC, thiol reductant ABC exporter, CydC sub	2e-06
PRK14274		259	PRK14274, PRK14274, phosphate ABC transporter ATP-bindi	2e-06
KOG0066		807	KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC	3e-06
PRK14268		258	PRK14268, PRK14268, phosphate ABC transporter ATP-bindi	3e-06
PRK10247		225	PRK10247, PRK10247, putative ABC transporter ATP-bindin	3e-06
COG4778		235	COG4778, PhnL, ABC-type phosphonate transport system, A	4e-06
TIGR02982		220	TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su	4e-06
PRK11607		377	PRK11607, potG, putrescine transporter ATP-binding subu	4e-06
TIGR00955		617	TIGR00955, 3a01204, The Eye Pigment Precursor Transport	6e-06
TIGR01187		325	TIGR01187, potA, spermidine/putrescine ABC transporter	9e-06
cd03279		213	cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) co	1e-05
PRK14237		267	PRK14237, PRK14237, phosphate transporter ATP-binding p	1e-05
TIGR02324		224	TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p	1e-05
PRK14241		258	PRK14241, PRK14241, phosphate transporter ATP-binding p	1e-05
TIGR01184		230	TIGR01184, ntrCD, nitrate transport ATP-binding subunit	2e-05
PRK14261		253	PRK14261, PRK14261, phosphate ABC transporter ATP-bindi	2e-05
PRK14249		251	PRK14249, PRK14249, phosphate ABC transporter ATP-bindi	2e-05
PRK15056		272	PRK15056, PRK15056, manganese/iron transporter ATP-bind	5e-05
PRK10584		228	PRK10584, PRK10584, putative ABC transporter ATP-bindin	6e-05
PRK10938		490	PRK10938, PRK10938, putative molybdenum transport ATP-b	7e-05
PRK14270		251	PRK14270, PRK14270, phosphate ABC transporter ATP-bindi	7e-05
PRK14235		267	PRK14235, PRK14235, phosphate transporter ATP-binding p	8e-05
PRK10744		260	PRK10744, pstB, phosphate transporter ATP-binding prote	8e-05
cd03231		201	cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding	9e-05
cd03278		197	cd03278, ABC_SMC_barmotin, Barmotin is a tight junction	1e-04
PRK14258		261	PRK14258, PRK14258, phosphate ABC transporter ATP-bindi	2e-04
PRK09473		330	PRK09473, oppD, oligopeptide transporter ATP-binding co	2e-04
KOG0060		659	KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor	3e-04
PLN03073		718	PLN03073, PLN03073, ABC transporter F family; Provision	3e-04
COG4178		604	COG4178, COG4178, ABC-type uncharacterized transport sy	7e-04
PRK10253		265	PRK10253, PRK10253, iron-enterobactin transporter ATP-b	8e-04
PRK10636		638	PRK10636, PRK10636, putative ABC transporter ATP-bindin	0.001
cd03223		166	cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding	0.002
PRK14265		274	PRK14265, PRK14265, phosphate ABC transporter ATP-bindi	0.002
TIGR03265		353	TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC	0.002
COG1245		591	COG1245, COG1245, Predicted ATPase, RNase L inhibitor (	0.003
PRK13543		214	PRK13543, PRK13543, cytochrome c biogenesis protein Ccm	0.003
PRK13548		258	PRK13548, hmuV, hemin importer ATP-binding subunit; Pro	5e-13
cd00267		157	cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo	6e-09
PRK09493		240	PRK09493, glnQ, glutamine ABC transporter ATP-binding p	7e-09
PRK13538		204	PRK13538, PRK13538, cytochrome c biogenesis protein Ccm	2e-08
TIGR02315		243	TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b	2e-08
PRK11160		574	PRK11160, PRK11160, cysteine/glutathione ABC transporte	4e-08
cd03246		173	cd03246, ABCC_Protease_Secretion, This family represent	5e-08
PRK11650		356	PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi	1e-07
PRK13539		207	PRK13539, PRK13539, cytochrome c biogenesis protein Ccm	1e-07
TIGR03796		710	TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC	2e-07
TIGR03269		520	TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase	5e-07
TIGR03797		686	TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC	1e-06
PRK15064		530	PRK15064, PRK15064, ABC transporter ATP-binding protein	1e-05
PRK10535		648	PRK10535, PRK10535, macrolide transporter ATP-binding /	2e-05
PRK10982		491	PRK10982, PRK10982, galactose/methyl galaxtoside transp	2e-05
PRK09452		375	PRK09452, potA, putrescine/spermidine ABC transporter A	2e-05
PRK10522		547	PRK10522, PRK10522, multidrug transporter membrane comp	3e-05
PRK11231		255	PRK11231, fecE, iron-dicitrate transporter ATP-binding	3e-05
PRK13547		272	PRK13547, hmuV, hemin importer ATP-binding subunit; Pro	8e-05
PRK06547		172	PRK06547, PRK06547, hypothetical protein; Provisional	8e-05
PRK11701		258	PRK11701, phnK, phosphonate C-P lyase system protein Ph	9e-05
cd03221		144	cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3	1e-04
PRK11831		269	PRK11831, PRK11831, putative ABC transporter ATP-bindin	2e-04
TIGR02673		214	TIGR02673, FtsE, cell division ATP-binding protein FtsE	2e-04
COG4615		546	COG4615, PvdE, ABC-type siderophore export system, fuse	3e-04
PTZ00243		1560	PTZ00243, PTZ00243, ABC transporter; Provisional	4e-04
TIGR03719		552	TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein,	5e-04
TIGR00960		216	TIGR00960, 3a0501s02, Type II (General) Secretory Pathw	5e-04
PRK10771		232	PRK10771, thiQ, thiamine transporter ATP-binding subuni	6e-04
TIGR01189		198	TIGR01189, ccmA, heme ABC exporter, ATP-binding protein	6e-04
cd03289		275	cd03289, ABCC_CFTR2, The CFTR subfamily domain 2	8e-04
TIGR01257		2272	TIGR01257, rim_protein, retinal-specific rim ABC transp	0.001
PRK10851		353	PRK10851, PRK10851, sulfate/thiosulfate transporter sub	0.001
PRK11248		255	PRK11248, tauB, taurine transporter ATP-binding subunit	0.002
PRK09984		262	PRK09984, PRK09984, phosphonate/organophosphate ester t	0.002
PLN02748		468	PLN02748, PLN02748, tRNA dimethylallyltransferase	0.002
TIGR03719		552	TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein,	0.003
PRK11819		556	PRK11819, PRK11819, putative ABC transporter ATP-bindin	0.003
TIGR01194		555	TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter	0.003
PRK13409		590	PRK13409, PRK13409, putative ATPase RIL; Provisional	0.004
TIGR03410		230	TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b	3e-12
cd00267		157	cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo	2e-09
KOG0066		807	KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC	1e-07
PRK11160		574	PRK11160, PRK11160, cysteine/glutathione ABC transporte	1e-06
cd03221		144	cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3	2e-05
PRK11174		588	PRK11174, PRK11174, cysteine/glutathione ABC transporte	6e-05
cd03227		162	cd03227, ABC_Class2, ABC-type Class 2 contains systems	1e-04
TIGR03796		710	TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC	1e-04
cd03246		173	cd03246, ABCC_Protease_Secretion, This family represent	4e-04
PTZ00265		1466	PTZ00265, PTZ00265, multidrug resistance protein (mdr1)	0.002
cd03239		178	cd03239, ABC_SMC_head, The structural maintenance of ch	0.003
pfam00005		119	pfam00005, ABC_tran, ABC transporter	6e-09
PLN03073		718	PLN03073, PLN03073, ABC transporter F family; Provision	3e-04
PTZ00265		1466	PTZ00265, PTZ00265, multidrug resistance protein (mdr1)	0.003

>gnl\|CDD\|162636 TIGR01978, sufC, FeS assembly ATPase SufC	Back alignment and domain information

>gnl\|CDD\|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>gnl\|CDD\|177053 CHL00131, ycf16, sulfate ABC transporter protein; Validated	Back alignment and domain information

>gnl\|CDD\|72976 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>gnl\|CDD\|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>gnl\|CDD\|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>gnl\|CDD\|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>gnl\|CDD\|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>gnl\|CDD\|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>gnl\|CDD\|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>gnl\|CDD\|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>gnl\|CDD\|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>gnl\|CDD\|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>gnl\|CDD\|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>gnl\|CDD\|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>gnl\|CDD\|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>gnl\|CDD\|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|73004 cd03245, ABCC_bacteriocin_exporters, ABC-type bacteriocin exporters	Back alignment and domain information

>gnl\|CDD\|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>gnl\|CDD\|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>gnl\|CDD\|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>gnl\|CDD\|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>gnl\|CDD\|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>gnl\|CDD\|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>gnl\|CDD\|73022 cd03263, ABC_subfamily_A, The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>gnl\|CDD\|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>gnl\|CDD\|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>gnl\|CDD\|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|35279 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>gnl\|CDD\|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>gnl\|CDD\|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|163239 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family	Back alignment and domain information

>gnl\|CDD\|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>gnl\|CDD\|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|179632 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>gnl\|CDD\|34862 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|162132 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>gnl\|CDD\|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE	Back alignment and domain information

>gnl\|CDD\|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|34291 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>gnl\|CDD\|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|35288 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>gnl\|CDD\|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC	Back alignment and domain information

>gnl\|CDD\|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|73027 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>gnl\|CDD\|31298 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|73025 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>gnl\|CDD\|31329 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter	Back alignment and domain information

>gnl\|CDD\|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|32537 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|73007 cd03248, ABCC_TAP, TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>gnl\|CDD\|73024 cd03265, ABC_DrrA, DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>gnl\|CDD\|33892 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|163576 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>gnl\|CDD\|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>gnl\|CDD\|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>gnl\|CDD\|72993 cd03234, ABCG_White, The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>gnl\|CDD\|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>gnl\|CDD\|72975 cd03216, ABC_Carb_Monos_I, This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>gnl\|CDD\|163251 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>gnl\|CDD\|182444 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>gnl\|CDD\|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>gnl\|CDD\|33909 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|178750 PLN03211, PLN03211, ABC transporter G-25; Provisional	Back alignment and domain information

>gnl\|CDD\|162558 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>gnl\|CDD\|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>gnl\|CDD\|184595 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|73011 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>gnl\|CDD\|31316 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>gnl\|CDD\|36145 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>gnl\|CDD\|36145 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>gnl\|CDD\|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>gnl\|CDD\|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>gnl\|CDD\|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>gnl\|CDD\|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|130260 TIGR01192, chvA, glucan exporter ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>gnl\|CDD\|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|184589 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|72979 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>gnl\|CDD\|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>gnl\|CDD\|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|33894 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>gnl\|CDD\|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|73003 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamily C	Back alignment and domain information

>gnl\|CDD\|35285 KOG0062, KOG0062, KOG0062, ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism, Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|72974 cd03215, ABC_Carb_Monos_II, This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>gnl\|CDD\|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|73028 cd03269, ABC_putative_ATPase, This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>gnl\|CDD\|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>gnl\|CDD\|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>gnl\|CDD\|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>gnl\|CDD\|184206 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>gnl\|CDD\|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|72992 cd03233, ABC_PDR_domain1, The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>gnl\|CDD\|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>gnl\|CDD\|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|34224 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>gnl\|CDD\|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD	Back alignment and domain information

>gnl\|CDD\|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>gnl\|CDD\|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|184123 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>gnl\|CDD\|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|73051 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>gnl\|CDD\|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|139715 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|184193 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>gnl\|CDD\|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|35285 KOG0062, KOG0062, KOG0062, ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism, Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>gnl\|CDD\|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|184124 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>gnl\|CDD\|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|183084 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>gnl\|CDD\|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>gnl\|CDD\|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|169949 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed	Back alignment and domain information

>gnl\|CDD\|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>gnl\|CDD\|33864 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|33903 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2	Back alignment and domain information

>gnl\|CDD\|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|72995 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>gnl\|CDD\|72991 cd03232, ABC_PDR_domain2, The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>gnl\|CDD\|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>gnl\|CDD\|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|182707 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>gnl\|CDD\|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>gnl\|CDD\|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|73061 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>gnl\|CDD\|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178771 PLN03232, PLN03232, ABC transporter C family member; Provisional	Back alignment and domain information

>gnl\|CDD\|162807 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>gnl\|CDD\|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|162131 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>gnl\|CDD\|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>gnl\|CDD\|184194 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|33907 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|182605 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|73047 cd03288, ABCC_SUR2, The SUR domain 2	Back alignment and domain information

>gnl\|CDD\|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>gnl\|CDD\|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional	Back alignment and domain information

>gnl\|CDD\|184201 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|73050 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1	Back alignment and domain information

>gnl\|CDD\|182443 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>gnl\|CDD\|73009 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamily C	Back alignment and domain information

>gnl\|CDD\|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|178676 PLN03130, PLN03130, ABC transporter C family member; Provisional	Back alignment and domain information

>gnl\|CDD\|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|30745 COG0396, SufC, ABC-type transport system involved in Fe-S cluster assembly, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit	Back alignment and domain information

>gnl\|CDD\|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>gnl\|CDD\|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters	Back alignment and domain information

>gnl\|CDD\|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>gnl\|CDD\|35282 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism, General function prediction only]	Back alignment and domain information

>gnl\|CDD\|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>gnl\|CDD\|33919 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>gnl\|CDD\|130045 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|163352 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>gnl\|CDD\|184197 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|73026 cd03267, ABC_NatA_like, Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>gnl\|CDD\|184591 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|34177 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

Protein GIs
254781041	254781042
254781043	254781044
254781045	254781046
254781047	254781048
254781049	254781050
254781051	254781052
254781053	254781054
254781055	254781056
254781057	254781058
peg_993	254781059
254781060	254781061
254781062	254781063
254781064	254781065
254781066	254781067
254781068	254781069
254781070	254781071
254781072	254781073
254781074	254781075
254781076	254781077
254781078	254781079
254781080	254781081
254781082	254781083
254781084	254781085
254781086	254781087
254781088	254781089
254781090	254781091
254781092	254781093
254781094	254781095
254781096	254781097
254781098	254781099
254781100	254781101
254781102	254781103
254781104	255764511
254781106	254781107
254781108	254781109
254781110	peg_1044
254781111	254781112
254781113	254781114
254781115	255764512
255764513	254781118
254781119	254781120
254781121	254781122
254781123	254781124
254781125	peg_1058
254781126	254781127
254781128	254781129
254781130	254781131
peg_1064	254781132
254781133	254781134
254781135	254781136
254781137	254781138
254781139	254781140
peg_1073	peg_1074
254781141	254781142
254781143	254781144
254781145	peg_1078
peg_1079	peg_1080
254781146	254781147
peg_1083	254781148
254781149	peg_1086
peg_1087	254781150
254781151	254781152
peg_1090	254781153
254781154	254781155
254781156	254781157
254781158	254781159
peg_1096	254781160
254781161	254781162
254781163	peg_1101
254781164	254781165
254781166	254781167
254781168	254781169
peg_1107	254781170
254781171	254781172
255764514	254781174
254781175	254781176
254781177	254781178
254781179	254781180
254781181	peg_1120
254781182	254781183
peg_1123	254781184
254781185	254781186
254781187	254781188
peg_1128	254781189
254781190	254781191
254781192	254781193
254781194	255764515
254781196	254781197
254781198	254781199
peg_1140	255764516
peg_1142	255764517
254781202	254781203
254781204	254781205
254781206	254781207
254781208	254781209
254781210	254781211
254781212	254781213
254781214	254781215
254781216	254781217
254781218	254781219
254781220	254781221
254781222	254781223
254781224	254781225
254781226	254781227
254781228	254780122
254780123	254780124
254780125	254780126
254780127	254780128
254780129	254780130
254780131	254780132
254780133	254780134
254780135	254780136
peg_15	254780137
254780138	254780139
254780140	254780141
peg_21	254780142
254780143	254780144
254780145	peg_26
254780146	254780147
254780148	254780149
254780150	254780151
peg_33	peg_34
254780152	peg_36
254780153	254780154
254780155	254780156
254780157	254780158
peg_42	254780159
254780160	254780161
254780162	254780163
254780164	254780165
254780166	254780167
254780168	254780169
peg_54	254780170
254780171	254780172
254780173	254780174
peg_60	254780175
254780176	254780177
254780178	254780179
254780180	254780181
254780182	254780183
254780184	254780185
254780186	254780187
254780188	peg_74
peg_75	254780189
254780190	254780191
255764460	peg_80
254780193	peg_82
254780194	254780195
254780196	254780197
254780198	254780199
254780200	254780201
254780202	peg_91
254780203	254780204
254780205	254780206
254780207	254780208
peg_97	peg_98
254780209	254780210
254780211	254780212
254780213	254780214
254780215	255764461
254780217	254780218
254780219	254780220
peg_109	254780221
254780222	254780223
254780224	254780225
254780226	peg_116
254780227	254780228
254780229	254780230
254780231	254780232
254780233	254780234
254780235	254780236
254780237	peg_128
254780238	254780239
254780240	254780241
254780242	254780243
254780244	254780245
254780246	254780247
254780248	254780249
254780250	254780251
254780252	254780253
254780254	254780255
254780256	254780257
254780258	254780259
254780260	254780261
254780262	254780263
254780264	254780265
254780266	254780267
254780268	254780269
254780270	254780271
254780272	254780273
254780274	peg_166
254780275	254780276
254780277	254780278
254780279	254780280
254780281	254780282
254780283	254780284
254780285	254780286
254780287	254780288
254780289	254780290
254780291	254780292
254780293	peg_186
254780294	254780295
255764462	254780297
peg_191	254780298
254780299	254780300
254780301	254780302
254780303	254780304
254780305	254780306
254780307	254780308
254780309	254780310
peg_204	254780311
254780312	254780313
254780314	254780315
254780316	254780317
254780318	254780319
254780320	254780321
254780322	254780323
peg_218	254780324
254780325	254780326
254780327	254780328
peg_224	254780329
254780330	peg_227
254780331	254780332
254780333	254780334
peg_232	254780335
peg_233	254780336
254780337	254780338
peg_237	254780339
254780340	254780341
254780342	254780343
254780344	254780345
254780346	254780347
254780348	peg_248
254780349	254780350
254780351	peg_252
255764463	peg_254
254780353	254780354
254780355	254780356
254780357	255764464
254780359	254780360
254780361	255764465
254780363	254780364
254780365	255764466
254780367	254780368
254780369	254780370
254780371	254780372
254780373	254780374
254780375	254780376
254780377	254780378
254780379	254780380
254780381	254780382
254780383	254780384
255764467	254780386
254780387	254780388
254780389	254780390
254780391	254780392
255764468	255764469
254780395	peg_298
254780396	254780397
254780398	254780399
254780400	254780401
254780402	254780403
254780404	254780405
254780406	254780407
254780408	254780409
254780410	254780411
254780412	254780413
254780414	255764470
254780416	254780417
254780418	254780419
254780420	254780421
255764471	254780423
254780424	254780425
254780426	peg_330
254780427	255764472
254780429	254780430
254780431	254780432
255764473	254780434
254780435	254780436
254780437	254780438
254780439	254780440
255764474	254780442
254780443	peg_348
peg_349	254780444
254780445	254780446
254780447	254780448
254780449	254780450
254780451	254780452
254780453	254780454
peg_360	254780455
254780456	peg_363
254780457	254780458
254780459	254780460
254780461	254780462
254780463	254780464
254780465	254780466
peg_374	254780467
254780468	254780469
254780470	254780471
254780472	254780473
254780474	254780475
254780476	254780477
254780478	254780479
254780480	254780481
254780482	254780483
254780484	peg_393
peg_394	254780485
254780486	254780487
254780488	254780489
254780490	254780491
254780492	254780829
254780828	254780827
254780826	255764475
255764476	254780824
254780823	peg_409
peg_410	254780822
254780821	254780820
peg_414	255764477
254780818	254780817
254780816	254780815
254780814	254780813
254780812	254780811
peg_423	254780810
254780809	254780808
254780807	254780806
254780805	254780804
254780803	254780802
254780801	254780800
254780799	254780798
254780797	254780796
254780795	254780794
254780793	255764478
254780791	254780790
254780789	254780788
254780787	254780786
254780785	254780784
254780783	254780782
255764479	254780781
254780780	peg_455
255764480	254780779
254780778	254780777
254780776	254780775
254780774	254780773
254780772	254780771
254780770	255764481
254780768	254780767
254780766	254780765
254780764	peg_472
peg_473	254780763
254780762	peg_476
peg_477	254780761
254780760	254780759
254780758	254780757
255764482	254780755
254780754	254780753
254780752	254780751
254780750	254780749
254780748	254780747
peg_493	254780746
254780745	254780744
254780743	254780742
254780741	254780740
254780739	255764483
254780737	254780736
254780735	254780734
254780733	254780732
peg_509	255764484
254780730	254780729
254780728	254780727
255764485	254780725
254780724	254780723
254780722	254780721
254780720	254780719
254780718	peg_523
254780717	254780716
254780715	254780714
254780713	254780712
254780711	254780710
peg_532	254780709
254780708	254780707
255764486	254780705
254780704	254780703
255764487	254780701
peg_542	254780700
254780699	254780698
254780697	254780696
254780695	254780694
254780693	254780692
254780691	254780690
254780689	254780688
254780687	255764488
254780685	254780684
254780683	254780682
255764489	254780680
peg_563	254780679
254780678	254780677
254780676	254780675
254780674	peg_568
254780673	255764490
254780671	254780670
254780669	peg_574
254780668	254780667
254780666	255764491
peg_577	254780664
254780663	254780662
254780661	peg_582
254780660	254780659
254780658	254780657
255764492	254780655
254780654	254780653
254780652	254780651
254780650	peg_593
254780649	254780648
254780647	254780646
peg_598	254780645
254780644	255764493
254780642	254780641
254780640	peg_603
254780639	254780638
255764494	254780636
254780635	254780634
254780633	254780632
254780631	peg_612
254780630	254780629
254780628	254780627
254780626	254780625
254780624	254780623
254780622	254780621
254780620	254780619
254780618	254780617
254780616	254780615
254780614	254780613
254780612	254780611
254780610	peg_634
255764495	254780608
254780607	254780606
254780605	254780604
254780603	254780602
254780601	254780600
255764496	254780598
255764497	254780596
254780595	254780594
254780593	254780592
254780591	254780590
254780589	254780588
255764498	peg_658
254780586	254780585
254780584	254780583
254780582	254780581
255764499	254780579
254780578	254780577
254780576	254780575
255764500	peg_671
254780573	254780572
254780571	254780570
254780569	254780568
254780567	254780565
254780564	254780563
254780562	peg_683
254780561	255764501
254780559	254780558
254780557	254780556
254780555	peg_691
254780554	254780553
254780552	254780551
255764502	254780549
254780548	254780547
254780546	254780545
254780544	254780543
254780542	255764503
254780540	254780539
254780538	254780537
254780536	254780535
254780534	254780533
254780532	254780531
254780530	254780529
254780528	254780527
254780526	254780525
254780524	254780523
254780522	254780521
254780520	254780519
254780518	255764504
254780516	254780515
254780514	254780513
254780512	254780511
254780510	254780509
254780508	254780507
254780506	254780505
254780504	254780503
254780502	254780501
254780500	254780499
254780498	254780497
254780496	254780495
254780494	254780493
254780830	254780831
254780832	254780833
peg_753	peg_754
254780834	255764505
254780836	254780837
peg_759	254780838
254780839	254780840
254780841	254780842
254780843	254780844
254780845	254780846
254780847	254780848
254780849	254780850
254780851	254780852
254780853	254780854
254780855	254780856
254780857	254780858
254780859	254780860
254780861	254780862
254780863	254780864
254780865	254780866
254780867	254780868
254780869	peg_786
254780870	peg_788
peg_789	254780871
254780872	254780873
254780874	254780875
254780876	254780877
254780878	254780879
254780880	254780881
254780882	254780883
255764506	254780885
254780886	254780887
254780888	peg_804
254780889	254780890
254780891	254780892
254780893	254780894
254780895	254780896
peg_813	254780897
254780898	peg_816
peg_817	peg_818
254780899	254780900
254780901	254780902
254780903	254780904
254780905	254780906
254780907	254780908
254780909	255764507
254780911	254780912
254780913	254780914
peg_834	254780915
254780916	254780917
254780918	254780919
254780920	254780921
254780922	254780923
254780924	254780925
254780926	254780927
254780928	254780929
254780930	254780931
peg_851	peg_852
254780932	254780933
254780934	254780935
254780936	254780937
254780938	254780939
254780940	254780941
254780942	254780943
254780944	254780945
254780946	254780947
peg_869	254780948
254780949	255764508
peg_873	peg_874
254780951	254780952
254780953	254780954
254780955	peg_880
254780956	254780957
254780958	254780959
peg_885	254780960
peg_887	peg_888
peg_889	254780961
254780962	254780963
254780964	254780965
254780966	254780967
254780968	254780969
254780970	254780971
254780972	254780973
254780974	254780975
peg_905	254780976
254780977	254780978
254780979	254780980
peg_911	peg_912
254780981	peg_913
254780982	254780983
peg_916	254780984
254780985	254780986
254780987	254780988
254780989	254780990
254780991	254780992
254780993	254780994
254780995	254780996
254780997	254780998
254780999	peg_930
peg_931	254781000
254781001	254781002
254781003	254781004
peg_937	254781005
254781006	254781007
254781008	peg_942
254781009	254781010
peg_945	254781011
254781012	254781013
254781014	peg_950
254781015	254781016
254781017	254781018
254781019	254781020
255764509	254781022
254781023	254781024
254781025	peg_961
254781026	254781027
254781028	254781029
254781030	254781031
254781032	254781033
254781034	255764510
254781036	254781037
254781038	254781039
254781040