254781071

254781071

hypothetical protein CLIBASIA_04865

GeneID in NCBI database:8210094Locus tag:CLIBASIA_04865
Protein GI in NCBI database:254781071Protein Accession:YP_003065484.1
Gene range:+(1072985, 1073200)Protein Length:71aa
Gene description:hypothetical protein
COG prediction:[G] Beta-glucosidase-related glycosidases
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70-
MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKMKT
ccHHHHHHHHHHHHHccHHHHHHEEEcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHcHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccc
MRWAFKALLALIACKWNLSRIIAVYnagadqqdpADVIELIYAHVKsgeikpsrIESAYQRIIYLKNKMKT
MRWAFKALLALIACKWNLSRIIAVYNagadqqdpADVIELIYAHVksgeikpsriesaYQRIIYLKNKMKT
MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKMKT
***AF*ALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKS**I***RIESAYQRIIYLKN****
MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKMKT
MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKM**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKMKT
MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKMKT
MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKMKT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target71 hypothetical protein CLIBASIA_04865 [Candidatus Liberib
238898650158 putative glycosy hydrolase family protein [Candidatus H 1 2e-11
270157239380 glycosyl hydrolase [Legionella longbeachae D-4968] Leng 1 2e-04
254495931379 glycosy hydrolase family protein [Legionella drancourti 1 0.002
54294135382 hypothetical protein lpl1199 [Legionella pneumophila st 2 1e-06
54297148382 hypothetical protein lpp1193 [Legionella pneumophila st 2 2e-06
296106822378 beta-N-acetylhexosaminidase [Legionella pneumophila 230 2 2e-06
307609946378 hypothetical protein LPW_12471 [Legionella pneumophila 2 2e-06
148358777382 glycosyl hydrolase family transporter 3 [Legionella pne 2 2e-06
52841424395 glycosy hydrolase family protein [Legionella pneumophil 2 2e-06
304413318353 glycosyl hydrolase domain-containing hypothetical prote 2 3e-04
>gi|238898650|ref|YP_002924331.1| putative glycosy hydrolase family protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 158 Back     alignment and organism information
 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (69%), Gaps = 12/73 (16%)

Query: 9   LALIACKWNLSRIIAVY-NAGADQ-----------QDPADVIELIYAHVKSGEIKPSRIE 56
           ++ IA  ++LS  + +  NAGAD            Q+PADVI+LIYAHVKSGEIK SRIE
Sbjct: 72  MSAIADNYSLSEALKLSINAGADMLIFSNQQSPVWQNPADVIDLIYAHVKSGEIKSSRIE 131

Query: 57  SAYQRIIYLKNKM 69
           SAYQRII+LK K+
Sbjct: 132 SAYQRIIHLKKKL 144


Species: Candidatus Hamiltonella defensa
Genus: Candidatus Hamiltonella
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|270157239|ref|ZP_06185896.1| glycosyl hydrolase [Legionella longbeachae D-4968] Length = 380 Back     alignment and organism information
>gi|254495931|ref|ZP_05108839.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] Length = 379 Back     alignment and organism information
>gi|54294135|ref|YP_126550.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] Length = 382 Back     alignment and organism information
>gi|54297148|ref|YP_123517.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] Length = 382 Back     alignment and organism information
>gi|296106822|ref|YP_003618522.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 378 Back     alignment and organism information
>gi|307609946|emb|CBW99474.1| hypothetical protein LPW_12471 [Legionella pneumophila 130b] Length = 378 Back     alignment and organism information
>gi|148358777|ref|YP_001249984.1| glycosyl hydrolase family transporter 3 [Legionella pneumophila str. Corby] Length = 382 Back     alignment and organism information
>gi|52841424|ref|YP_095223.1| glycosy hydrolase family protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 395 Back     alignment and organism information
>gi|304413318|ref|ZP_07394791.1| glycosyl hydrolase domain-containing hypothetical protein [Candidatus Regiella insecticola LSR1] Length = 353 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 71 hypothetical protein CLIBASIA_04865 [Candidatus Liberib
COG1472397 BglX Beta-glucosidase-related glycosidases [Carbohydrat 98.94
PRK05337336 beta-hexosaminidase; Provisional 96.77
pfam00933225 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal do 97.46
>COG1472 BglX Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05337 beta-hexosaminidase; Provisional Back     alignment and domain information
>pfam00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target71 hypothetical protein CLIBASIA_04865 [Candidatus Liberib
2x40_A 721 Structure Of Beta-Glucosidase 3b From Thermotoga Ne 2e-10
2x42_A 721 Structure Of Beta-Glucosidase 3b From Thermotoga Ne 8e-10
3f93_A 822 Crystal Structure Of Exo-1,31,4-Beta-Glucanase (Exo 2e-08
1lq2_A 602 Crystal Structure Of Barley Beta-D-Glucan Glucohydr 3e-07
1ex1_A 605 Beta-D-Glucan Exohydrolase From Barley Length = 605 3e-07
3bmx_A 642 Beta-N-Hexosaminidase (Ybbd) From Bacillus Subtilis 6e-07
3ac0_A 845 Crystal Structure Of Beta-Glucosidase From Kluyvero 0.002
>gi|288562868|pdb|2X40|A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Glycerol Length = 721 Back     alignment and structure
 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 11/74 (14%), Positives = 25/74 (33%), Gaps = 12/74 (16%)

Query: 2   RWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVI----------ELIYAHVKSGEIK 51
            W F+  +  ++  +     +    AG D   P              E I   +K G++ 
Sbjct: 232 EWGFEGFV--MSDWYAGDNPVEQLKAGNDLIMPGKAYQVNTERRDEIEEIMEALKEGKLS 289

Query: 52  PSRIESAYQRIIYL 65
              ++   + I+ +
Sbjct: 290 EEVLDECVRNILKV 303


>gi|288562870|pdb|2X42|A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Alpha-D-Glucose Length = 721 Back     alignment and structure
>gi|268612262|pdb|3F93|A Chain A, Crystal Structure Of Exo-1,31,4-Beta-Glucanase (Exop) From Pseudoalteromonas Sp. Bb1 Length = 822 Back     alignment and structure
>gi|39654150|pdb|1LQ2|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole Length = 602 Back     alignment and structure
>gi|6573536|pdb|1EX1|A Chain A, Beta-D-Glucan Exohydrolase From Barley Length = 605 Back     alignment and structure
gi|218681747|pdb|3BMX|A Chain A, Beta-N-Hexosaminidase (Ybbd) From Bacillus Subtilis Length = 642 Back     alignment and structure
>gi|302566017|pdb|3AC0|A Chain A, Crystal Structure Of Beta-Glucosidase From Kluyveromyces Marxianus In Complex With Glucose Length = 845 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target71 hypothetical protein CLIBASIA_04865 [Candidatus Liberib
3f94_A 822 Beta-glucosidase; (alpha/beta)8 barrel, (alpha/beta)6 s 99.57
3bmx_A 642 Uncharacterized lipoprotein YBBD; beta-N-hexosaminidase 99.53
1x38_A 602 Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domain fol 99.49
3abz_A 845 Beta-glucosidase I; glycoside hydrolase family3 beta-gl 99.41
2x41_A 721 Beta-glucosidase; hydrolase, TIM barrel fold, fibronect 99.37
2oxn_A340 Beta-hexosaminidase; TIM-barrel, hydrolase; HET: OAN; 1 98.31
>3f94_A Beta-glucosidase; (alpha/beta)8 barrel, (alpha/beta)6 sheet, hydrolase; 2.30A {Pseudoalteromonas SP} PDB: 3f93_A Back     alignment and structure
Probab=99.57  E-value=8.2e-16  Score=108.02  Aligned_cols=66  Identities=26%  Similarity=0.380  Sum_probs=56.7

Q ss_pred             CCCCCHHHHHHHCCCCH---------HHHHHHHHCCCHHHHHHH----HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             75712037755412349---------999999972412454255----49999999997999989999999999999997
Q gi|254781071|r    2 RWAFKALLALIACKWNL---------SRIIAVYNAGADQQDPAD----VIELIYAHVKSGEIKPSRIESAYQRIIYLKNK   68 (71)
Q Consensus         2 ~W~f~g~~~~v~~~w~~---------~~~~~a~nAG~Dle~p~~----~~~~i~~aV~~G~i~~~~id~sv~RIL~lk~k   68 (71)
                      +|||+|+|   ++||+.         +..+.++|||+||+|++.    .++.+.++|++|+|++++||+||+|||++|+|
T Consensus       284 elGF~G~V---vSD~~~~~~~~~~~~e~~~~ai~AG~D~~m~~~~~~~~~~~l~~av~~G~i~e~rid~av~RIL~~k~~  360 (822)
T 3f94_A          284 QLGFDGFV---VSDWNAHKFVEGCDLEQCAQAINAGVDVIMVPEHFEAFYHNTVKQVKAGVIAESRINDAVRRFLRAKIR  360 (822)
T ss_dssp             CSCCCSEE---ECCTTGGGGSTTCBTTBCHHHHHHTCCBEECTTTHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHHHH
T ss_pred             HCCCCCCC---CCCHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             61889854---652102330247715658999854455345753233027889999874899899985999999999998


Q ss_pred             HC
Q ss_conf             36
Q gi|254781071|r   69 MK   70 (71)
Q Consensus        69 l~   70 (71)
                      +.
T Consensus       361 ~G  362 (822)
T 3f94_A          361 WG  362 (822)
T ss_dssp             HT
T ss_pred             HC
T ss_conf             48



>3bmx_A Uncharacterized lipoprotein YBBD; beta-N-hexosaminidase, TIM barrel, glycosidase, hydrolase, membrane, palmitate; HET: P4G; 1.40A {Bacillus subtilis} PDB: 3cqm_A* Back     alignment and structure
>1x38_A Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domain fold, ligand-protein complex; HET: NAG BMA FUC MAN IDD GOL; 1.70A {Hordeum vulgare} SCOP: c.1.8.7 c.23.11.1 PDB: 1lq2_A* 1x39_A* 1ex1_A* 1ieq_A* 1iev_A* 1iew_A* 1iex_A* 1j8v_A* Back     alignment and structure
>3abz_A Beta-glucosidase I; glycoside hydrolase family3 beta-glucosidase, PA14 domain, H; 2.15A {Kluyveromyces marxianus} PDB: 3ac0_A* Back     alignment and structure
>2x41_A Beta-glucosidase; hydrolase, TIM barrel fold, fibronectin type III fold; HET: BGC; 2.05A {Thermotoga neapolitana} PDB: 2x40_A* 2x42_A* Back     alignment and structure
>2oxn_A Beta-hexosaminidase; TIM-barrel, hydrolase; HET: OAN; 1.70A {Vibrio cholerae} PDB: 3gs6_A* 3gsm_A* 1y65_A* 1tr9_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target71 hypothetical protein CLIBASIA_04865 [Candidatus Liberib
d1x38a1388 Beta-D-glucan exohydrolase, N-terminal domain {Barley ( 99.47
d1tr9a_330 Beta-hexosaminidase NagZ {Vibrio cholerae [TaxId: 666]} 98.25
>d1x38a1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: NagZ-like
domain: Beta-D-glucan exohydrolase, N-terminal domain
species: Barley (Hordeum vulgare) [TaxId: 4513]
Probab=99.47  E-value=2.3e-14  Score=98.74  Aligned_cols=67  Identities=30%  Similarity=0.341  Sum_probs=57.4

Q ss_pred             CCCCCHHHHHHHCCCCH------------HHHHHHHHCCCHHHHHH----HHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
Q ss_conf             75712037755412349------------99999997241245425----549999999997999989999999999999
Q gi|254781071|r    2 RWAFKALLALIACKWNL------------SRIIAVYNAGADQQDPA----DVIELIYAHVKSGEIKPSRIESAYQRIIYL   65 (71)
Q Consensus         2 ~W~f~g~~~~v~~~w~~------------~~~~~a~nAG~Dle~p~----~~~~~i~~aV~~G~i~~~~id~sv~RIL~l   65 (71)
                      +|||+|+|  |+||++.            ...+.+++||.|+.+.+    .+++.|.++|++|+|++++||+||+|||++
T Consensus       275 ~~gF~G~V--vSD~~~m~~~~~~~~~~~~~~~~~a~~ag~d~~~~~~~~~~~~~~l~~av~~G~i~~~rid~sv~Ril~~  352 (388)
T d1x38a1         275 TLKFKGFV--ISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNKYQQFISILTGHVNGGVIPMSRIDDAVTRILRV  352 (388)
T ss_dssp             TSCCCSEE--ECCTTTTGGGSSSTTTTHHHHHHHHHHHTCCBEECCSCHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHH
T ss_pred             CCCCCCEE--ECCHHHCCCCCCCCCCCHHHHHHHHHHCCCCEECCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
T ss_conf             05997524--2422102331235677578999999851788134785389999999999985998999999999999999


Q ss_pred             HHHHC
Q ss_conf             99736
Q gi|254781071|r   66 KNKMK   70 (71)
Q Consensus        66 k~kl~   70 (71)
                      |+++.
T Consensus       353 k~~lG  357 (388)
T d1x38a1         353 KFTMG  357 (388)
T ss_dssp             HHHTT
T ss_pred             HHHHC
T ss_conf             99948



>d1tr9a_ c.1.8.7 (A:) Beta-hexosaminidase NagZ {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 71 hypothetical protein CLIBASIA_04865 [Candidatus Li
1x38_A_1-365365 (A:1-365) Beta-D-glucan exohydrolase isoenzyme EXO 0.002
>1x38_A (A:1-365) Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domain fold, ligand-protein complex; HET: NAG BMA FUC MAN IDD GOL; 1.70A {Hordeum vulgare}Length = 365 Back     alignment and structure
 Score = 35.8 bits (81), Expect = 0.002
 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 4/54 (7%)

Query: 20  RIIAVYNAGADQQ----DPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKM 69
            + A   AG D           I ++  HV  G I  SRI+ A  RI+ +K  M
Sbjct: 303 SVKASILAGLDMIMVPNKYQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTM 356


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target71 hypothetical protein CLIBASIA_04865 [Candidatus Liberib
1x38_A_1-365365 Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domai 99.46
3f94_A_1-397397 Beta-glucosidase; (alpha/beta)8 barrel, (alpha/bet 99.4
3bmx_A_1-419419 Uncharacterized lipoprotein YBBD; beta-N-hexosamin 99.38
2oxn_A_340 Beta-hexosaminidase; TIM-barrel, hydrolase; HET: O 99.28
2wt3_A_ 721 Beta-glucosidase; hydrolase, TIM barrel fold, fibr 99.15
>1x38_A (A:1-365) Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domain fold, ligand-protein complex; HET: NAG BMA FUC MAN IDD GOL; 1.70A {Hordeum vulgare} Back     alignment and structure
Probab=99.46  E-value=9.9e-14  Score=97.36  Aligned_cols=67  Identities=30%  Similarity=0.347  Sum_probs=57.9

Q ss_pred             CCCCCHHHHHHHCCCCH------------HHHHHHHHCCCHHHHHHH----HHHHHHHHHHCCCCCHHHHHHHHHHHHHH
Q ss_conf             75712037755412349------------999999972412454255----49999999997999989999999999999
Q gi|254781071|r    2 RWAFKALLALIACKWNL------------SRIIAVYNAGADQQDPAD----VIELIYAHVKSGEIKPSRIESAYQRIIYL   65 (71)
Q Consensus         2 ~W~f~g~~~~v~~~w~~------------~~~~~a~nAG~Dle~p~~----~~~~i~~aV~~G~i~~~~id~sv~RIL~l   65 (71)
                      +|||+|+|  |+||...            +.++.|++||+||+|+++    .++.|.+++++|.+++++||+||+|||++
T Consensus       275 ~~gF~G~v--isD~~~~~~l~~~~~~~~~~~~~~al~AG~Dl~l~~~~~~~~~~~l~~~v~~g~i~~~~id~a~~ril~~  352 (365)
T 1x38_A          275 TLKFKGFV--ISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNKYQQFISILTGHVNGGVIPMSRIDDAVTRILRV  352 (365)
T ss_dssp             TSCCCSEE--ECCTTTTGGGSSSTTTTHHHHHHHHHHHTCCBEECCSCHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHH
T ss_pred             CCCCCCEE--ECHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             26887356--4616688765513356643115688862764233554401111110221248964589999999999999


Q ss_pred             HHHHC
Q ss_conf             99736
Q gi|254781071|r   66 KNKMK   70 (71)
Q Consensus        66 k~kl~   70 (71)
                      |+|+.
T Consensus       353 k~~lg  357 (365)
T 1x38_A          353 KFTMG  357 (365)
T ss_dssp             HHHTT
T ss_pred             HHHHH
T ss_conf             98776



>3f94_A (A:1-397) Beta-glucosidase; (alpha/beta)8 barrel, (alpha/beta)6 sheet, hydrolase; 2.30A {Pseudoalteromonas SP} PDB: 3f93_A Back     alignment and structure
>3bmx_A (A:1-419) Uncharacterized lipoprotein YBBD; beta-N-hexosaminidase, TIM barrel, glycosidase, hydrolase, membrane, palmitate; HET: P4G; 1.40A {Bacillus subtilis} PDB: 3cqm_A* Back     alignment and structure
>2oxn_A (A:) Beta-hexosaminidase; TIM-barrel, hydrolase; HET: OAN; 1.70A {Vibrio cholerae} PDB: 3gs6_A* 3gsm_A* 1y65_A* 1tr9_A Back     alignment and structure