254781070

254781070

hypothetical protein CLIBASIA_04860

GeneID in NCBI database:8210093Locus tag:CLIBASIA_04860
Protein GI in NCBI database:254781070Protein Accession:YP_003065483.1
Gene range:+(1072588, 1072764)Protein Length:58aa
Gene description:hypothetical protein
COG prediction:[G] Beta-glucosidase-related glycosidases
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------
MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK
cccHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccc
cccHccccccEccccHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHcHHEccccc
maknlvtsginvnfspvldllygpetfiaQKRSIFSRIPAKAEESAQLFSRTYIKNPK
maknlvtsginvnfspvldLLYGPETFIAQKRSIFSripakaeesaqlfsrtyiknpk
MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK
***N*VTSGINVNFSPVLDLLYGPETFIAQKRS*FSR*PAKAEESAQLFSRT******
MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK
****LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK
MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK
MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target58 hypothetical protein CLIBASIA_04860 [Candidatus Liberib
304413318 353 glycosyl hydrolase domain-containing hypothetical prote 1 1e-05
153872146 436 glycosyl hydrolase, family 3 [Beggiatoa sp. PS] Length 2 5e-05
320353673 354 glycoside hydrolase family 3 domain-containing protein 2 8e-05
254495931 379 glycosy hydrolase family protein [Legionella drancourti 2 9e-05
153864860340 glycosyl hydrolase [Beggiatoa sp. SS] Length = 340 2 1e-04
307609946 378 hypothetical protein LPW_12471 [Legionella pneumophila 2 1e-04
52841424 395 glycosy hydrolase family protein [Legionella pneumophil 2 1e-04
296106822 378 beta-N-acetylhexosaminidase [Legionella pneumophila 230 2 1e-04
148358777 382 glycosyl hydrolase family transporter 3 [Legionella pne 2 1e-04
54297148 382 hypothetical protein lpp1193 [Legionella pneumophila st 2 1e-04
>gi|304413318|ref|ZP_07394791.1| glycosyl hydrolase domain-containing hypothetical protein [Candidatus Regiella insecticola LSR1] Length = 353 Back     alignment and organism information
 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 1   MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53
           M + LV +G+N NF+PV+DL + PETFIA     FS +P +  E+AQL S+ +
Sbjct: 116 MTETLVDAGVNTNFAPVVDL-HRPETFIAGAERSFSALPKEVAENAQLISQAH 167


Species: Candidatus Regiella insecticola
Genus: Candidatus Regiella
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|153872146|ref|ZP_02001121.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] Length = 436 Back     alignment and organism information
>gi|320353673|ref|YP_004195012.1| glycoside hydrolase family 3 domain-containing protein [Desulfobulbus propionicus DSM 2032] Length = 354 Back     alignment and organism information
>gi|254495931|ref|ZP_05108839.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] Length = 379 Back     alignment and organism information
>gi|153864860|ref|ZP_01997612.1| glycosyl hydrolase [Beggiatoa sp. SS] Length = 340 Back     alignment and organism information
>gi|307609946|emb|CBW99474.1| hypothetical protein LPW_12471 [Legionella pneumophila 130b] Length = 378 Back     alignment and organism information
>gi|52841424|ref|YP_095223.1| glycosy hydrolase family protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 395 Back     alignment and organism information
>gi|296106822|ref|YP_003618522.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 378 Back     alignment and organism information
>gi|148358777|ref|YP_001249984.1| glycosyl hydrolase family transporter 3 [Legionella pneumophila str. Corby] Length = 382 Back     alignment and organism information
>gi|54297148|ref|YP_123517.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] Length = 382 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target58 hypothetical protein CLIBASIA_04860 [Candidatus Liberib
COG1472 397 COG1472, BglX, Beta-glucosidase-related glycosidases [C 0.002
>gnl|CDD|31661 COG1472, BglX, Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 58 hypothetical protein CLIBASIA_04860 [Candidatus Liberib
PRK05337 336 beta-hexosaminidase; Provisional 99.64
COG1472 397 BglX Beta-glucosidase-related glycosidases [Carbohydrat 99.57
pfam00933 225 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal do 99.52
>PRK05337 beta-hexosaminidase; Provisional Back     alignment and domain information
>COG1472 BglX Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target58 hypothetical protein CLIBASIA_04860 [Candidatus Liberib
3bmx_A 642 Beta-N-Hexosaminidase (Ybbd) From Bacillus Subtilis 4e-08
3gs6_A 340 Vibrio Cholerea Family 3 Glycoside Hydrolase (Nagz) 3e-04
2oxn_A 340 Vibrio Cholerae Family 3 Glycoside Hydrolase (Nagz) 3e-04
1y65_A 342 Crystal Structure Of Beta-Hexosaminidase From Vibri 3e-04
gi|218681747|pdb|3BMX|A Chain A, Beta-N-Hexosaminidase (Ybbd) From Bacillus Subtilis Length = 642 Back     alignment and structure
 Score = 61.3 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 1   MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54
           + K L   GIN +FSPV+D+   P+  +      FS              +   
Sbjct: 160 IGKELSALGINTDFSPVVDINNNPDNPVIGV-RSFSSNRELTSRLGLYTMKGLQ 212


>gi|242556560|pdb|3GS6|A Chain A, Vibrio Cholerea Family 3 Glycoside Hydrolase (Nagz)in Complex With N-Butyryl-Pugnac Length = 340 Back     alignment and structure
>gi|149242757|pdb|2OXN|A Chain A, Vibrio Cholerae Family 3 Glycoside Hydrolase (Nagz) In Complex With Pugnac Length = 340 Back     alignment and structure
>gi|60594517|pdb|1Y65|A Chain A, Crystal Structure Of Beta-Hexosaminidase From Vibrio Cholerae In Complex With N-Acetyl-D-Glucosamine To A Resolution Of 1.85 Length = 342 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target58 hypothetical protein CLIBASIA_04860 [Candidatus Liberib
2oxn_A 340 Beta-hexosaminidase; TIM-barrel, hydrolase; HET: OAN; 1 99.48
2x41_A 721 Beta-glucosidase; hydrolase, TIM barrel fold, fibronect 99.37
3f94_A 822 Beta-glucosidase; (alpha/beta)8 barrel, (alpha/beta)6 s 99.25
3bmx_A 642 Uncharacterized lipoprotein YBBD; beta-N-hexosaminidase 99.24
3abz_A 845 Beta-glucosidase I; glycoside hydrolase family3 beta-gl 99.21
1x38_A 602 Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domain fol 98.84
>2oxn_A Beta-hexosaminidase; TIM-barrel, hydrolase; HET: OAN; 1.70A {Vibrio cholerae} PDB: 3gs6_A* 3gsm_A* 1y65_A* 1tr9_A Back     alignment and structure
Probab=99.48  E-value=1.9e-14  Score=102.57  Aligned_cols=53  Identities=21%  Similarity=0.310  Sum_probs=47.2

Q ss_pred             CHHHHHHCCCCCCCCEEEEECCCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             96899961896122114500468878714136775888899999999999999867
Q gi|254781070|r    1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN   56 (58)
Q Consensus         1 iA~~L~~~Gin~n~aPVlDi~~~~~~~i~~~~Rsfg~dp~~V~~~a~afi~~~~~n   56 (58)
                      +|+||+++|||||||||+|+..++  .+++ +||||+||+.|++++.+|++|++++
T Consensus       101 ~~~el~~~Gin~~~aPv~Dv~~~~--~~i~-~rsfg~Dp~~v~~~~~a~i~G~q~~  153 (340)
T 2oxn_A          101 MAAELIAHDVDLSFAPVLDMGFAC--KAIG-NRAFGEDVQTVLKHSSAFLRGMKAV  153 (340)
T ss_dssp             HHHHHHTTTCCEECCCBCCCCSCS--TTTG-GGSSCSSHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHCCCCCCCCCCCCCCCCC--CCEE-CCCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             999999829980557653666566--7311-1368889899999899986130223



>2x41_A Beta-glucosidase; hydrolase, TIM barrel fold, fibronectin type III fold; HET: BGC; 2.05A {Thermotoga neapolitana} PDB: 2x40_A* 2x42_A* Back     alignment and structure
>3f94_A Beta-glucosidase; (alpha/beta)8 barrel, (alpha/beta)6 sheet, hydrolase; 2.30A {Pseudoalteromonas SP} PDB: 3f93_A Back     alignment and structure
>3bmx_A Uncharacterized lipoprotein YBBD; beta-N-hexosaminidase, TIM barrel, glycosidase, hydrolase, membrane, palmitate; HET: P4G; 1.40A {Bacillus subtilis} PDB: 3cqm_A* Back     alignment and structure
>3abz_A Beta-glucosidase I; glycoside hydrolase family3 beta-glucosidase, PA14 domain, H; 2.15A {Kluyveromyces marxianus} PDB: 3ac0_A* Back     alignment and structure
>1x38_A Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domain fold, ligand-protein complex; HET: NAG BMA FUC MAN IDD GOL; 1.70A {Hordeum vulgare} SCOP: c.1.8.7 c.23.11.1 PDB: 1lq2_A* 1x39_A* 1ex1_A* 1ieq_A* 1iev_A* 1iew_A* 1iex_A* 1j8v_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target58 hypothetical protein CLIBASIA_04860 [Candidatus Liberib
d1tr9a_ 330 Beta-hexosaminidase NagZ {Vibrio cholerae [TaxId: 666]} 99.48
d1x38a1 388 Beta-D-glucan exohydrolase, N-terminal domain {Barley ( 98.9
>d1tr9a_ c.1.8.7 (A:) Beta-hexosaminidase NagZ {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: NagZ-like
domain: Beta-hexosaminidase NagZ
species: Vibrio cholerae [TaxId: 666]
Probab=99.48  E-value=1.1e-14  Score=102.59  Aligned_cols=53  Identities=21%  Similarity=0.310  Sum_probs=47.2

Q ss_pred             CHHHHHHCCCCCCCCEEEEECCCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             96899961896122114500468878714136775888899999999999999867
Q gi|254781070|r    1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN   56 (58)
Q Consensus         1 iA~~L~~~Gin~n~aPVlDi~~~~~~~i~~~~Rsfg~dp~~V~~~a~afi~~~~~n   56 (58)
                      +|+||+++|||||||||+|+..++  .+++ +||||+||+.|++++.+|++|++++
T Consensus       102 ~~~el~~~Gin~~~aPv~Dv~~~~--~~i~-~rsfg~Dp~~v~~~a~a~i~G~q~~  154 (330)
T d1tr9a_         102 MAAELIAHDVDLSFAPVLDMGFAC--KAIG-NRAFGEDVQTVLKHSSAFLRGMKAV  154 (330)
T ss_dssp             HHHHHHTTTCCEECCCBCCCCSCS--TTTG-GGSSCSSHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHCCCCCCCHHCCCCCCC--CHHH-HCCCCCCHHHHHHHHHHEEECCCCC
T ss_conf             889999838884400001355442--0454-3235432018777543415460233



>d1x38a1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target58 hypothetical protein CLIBASIA_04860 [Candidatus Liberib
3bmx_A_1-419 419 Uncharacterized lipoprotein YBBD; beta-N-hexosamin 99.36
3f94_A_1-397 397 Beta-glucosidase; (alpha/beta)8 barrel, (alpha/bet 99.34
2oxn_A_ 340 Beta-hexosaminidase; TIM-barrel, hydrolase; HET: O 99.18
2wt3_A_ 721 Beta-glucosidase; hydrolase, TIM barrel fold, fibr 99.17
1x38_A_1-365 365 Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domai 98.64
>3bmx_A (A:1-419) Uncharacterized lipoprotein YBBD; beta-N-hexosaminidase, TIM barrel, glycosidase, hydrolase, membrane, palmitate; HET: P4G; 1.40A {Bacillus subtilis} PDB: 3cqm_A* Back     alignment and structure
Probab=99.36  E-value=6.4e-13  Score=94.73  Aligned_cols=55  Identities=24%  Similarity=0.339  Sum_probs=51.4

Q ss_pred             CHHHHHHCCCCCCCCEEEEECCCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             96899961896122114500468878714136775888899999999999999867
Q gi|254781070|r    1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN   56 (58)
Q Consensus         1 iA~~L~~~Gin~n~aPVlDi~~~~~~~i~~~~Rsfg~dp~~V~~~a~afi~~~~~n   56 (58)
                      +|+|++++||||+|+||+|+.+++.+..++ .|+||+||..|++++.+|++|+|++
T Consensus       160 ~g~e~~a~Gi~~~~aPv~Di~~~p~~~r~~-~e~fgeDP~lv~~~~~a~v~G~q~~  214 (419)
T 3bmx_A          160 IGKELSALGINTDFSPVVDINNNPDNPVIG-VRSFSSNRELTSRLGLYTMKGLQRQ  214 (419)
T ss_dssp             HHHHHHHHTCCEECCCBCCCCCCTTCSSSG-GGSSCSSHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHCCCEEECCEECCCCCCCCCCCC-CCCCCCCHHHCCHHHHHHEECCHHH
T ss_conf             999999819998853666456786547456-6665557112101024520022023



>3f94_A (A:1-397) Beta-glucosidase; (alpha/beta)8 barrel, (alpha/beta)6 sheet, hydrolase; 2.30A {Pseudoalteromonas SP} PDB: 3f93_A Back     alignment and structure
>2oxn_A (A:) Beta-hexosaminidase; TIM-barrel, hydrolase; HET: OAN; 1.70A {Vibrio cholerae} PDB: 3gs6_A* 3gsm_A* 1y65_A* 1tr9_A Back     alignment and structure
>1x38_A (A:1-365) Beta-D-glucan exohydrolase isoenzyme EXOI; 2-domain fold, ligand-protein complex; HET: NAG BMA FUC MAN IDD GOL; 1.70A {Hordeum vulgare} Back     alignment and structure