254781073

254781073

coproporphyrinogen III oxidase

GeneID in NCBI database:8210097Locus tag:CLIBASIA_04875
Protein GI in NCBI database:254781073Protein Accession:YP_003065486.1
Gene range:+(1074982, 1075905)Protein Length:307aa
Gene description:coproporphyrinogen III oxidase
COG prediction:[H] Coproporphyrinogen III oxidase
KEGG prediction:coproporphyrinogen III oxidase (EC:1.3.3.3); K00228 coproporphyrinogen III oxidase [EC:1.3.3.3]
SEED prediction:Coproporphyrinogen III oxidase, aerobic (EC 1.3.3.3)
Pathway involved in KEGG:Porphyrin and chlorophyll metabolism [PATH:las00860]
Subsystem involved in SEED:Heme and Siroheme Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEcccccccccccccccccEEEEEccEEEEEEEEEEEEEEccccHHHHHHcccHHccccEEEEEEEEEEccccccccHHHHEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHccccHHHHcccccHHHHHHccccccccc
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHccccccccccccccccccccEEEEccccEEEEccEEEEEccccccHHHHHHccHHHcccccEEccEEEEEcccccccccEEccEEEEEEEHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHcccccHHcEcccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccEEEEEEEEccccEEcccccccEHHHHccccccEccc
mnlctieigcpddiEERKRISQRKFENLQSIICTEFEKleneahensanrspkiftvkhwlrdksqkedlgggrmatlCAGKVFEKAAVLVSTVygdlspdfkdqilgttknpyfwaTGLSVivhpynphvpavhFNIRMIVTGaywfgggidltpslesrrhsydpdviFFHNTLKEMCSQHAVANYTHYKewcdryfylphrqesrgiggiffdhlhsspemggidadfSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLydkgtnfgfktggnVESIlasmpplvawp
mnlctieigcpddieeRKRISQRKFENLQSIICTEFEKLeneahensanrspkiftvkhwLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILasmpplvawp
MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP
********************SQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLR*K***********ATLCAGKVFEKAAVLVSTVYGDLS**************YFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP
MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLE********NRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP
****TIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP
MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP
MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target307 coproporphyrinogen III oxidase [Candidatus Liberibacter
315122467307 coproporphyrinogen III oxidase [Candidatus Liberibacter 1 1e-142
241205750303 coproporphyrinogen III oxidase [Rhizobium leguminosarum 1 3e-97
116253236303 coproporphyrinogen III oxidase [Rhizobium leguminosarum 1 8e-96
190892790303 coproporphyrinogen III oxidase [Rhizobium etli CIAT 652 1 7e-95
209550365303 coproporphyrinogen III oxidase [Rhizobium leguminosarum 1 1e-94
325293608303 Coproporphyrinogen III oxidase [Agrobacterium sp. H13-3 1 7e-94
327188341303 coproporphyrinogen III oxidase protein [Rhizobium etli 1 9e-94
222086615303 coproporphyrinogen III oxidase protein [Agrobacterium r 1 1e-93
15889523303 coproporphyrinogen III oxidase [Agrobacterium tumefacie 1 2e-93
150396759303 coproporphyrinogen III oxidase [Sinorhizobium medicae W 1 3e-93
>gi|315122467|ref|YP_004062956.1| coproporphyrinogen III oxidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 307 Back     alignment and organism information
 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 237/306 (77%), Positives = 268/306 (87%)

Query: 1   MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW 60
           MNL  IE+G PD+IEE KR +QRKFENLQSIIC EFEKLENE   NS+N   +IF  KHW
Sbjct: 1   MNLGKIELGLPDNIEEWKRRAQRKFENLQSIICAEFEKLENELTGNSSNIPSEIFKSKHW 60

Query: 61  LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL 120
           +RDKS+K DLGGG MATL  GKVFEKAAVLVSTVYGDLS +F+DQI GT ++PYFWA GL
Sbjct: 61  VRDKSKKNDLGGGHMATLYGGKVFEKAAVLVSTVYGDLSVNFRDQIPGTLQSPYFWAAGL 120

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC 180
           SVI HPYNPHVPA+HFNIRMIVTGAYWFGGGIDLTP LESRR   DPDV+FFH++LK++ 
Sbjct: 121 SVIAHPYNPHVPAIHFNIRMIVTGAYWFGGGIDLTPFLESRRQLDDPDVMFFHDSLKKIF 180

Query: 181 SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC 240
           +QH VA+Y HYKEWCD+YFYLPHR+E+RG+GGIFFD+LHS  E+GGIDADFSF+SAVGDC
Sbjct: 181 AQHTVADYNHYKEWCDQYFYLPHREEARGVGGIFFDYLHSKQEIGGIDADFSFVSAVGDC 240

Query: 241 FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM 300
           F+ LYP LVRRNY   F++Q+RQEQLIRRGRY EFNLLYDKGTNFGFKTGGNVESILASM
Sbjct: 241 FVTLYPLLVRRNYRRSFTKQERQEQLIRRGRYVEFNLLYDKGTNFGFKTGGNVESILASM 300

Query: 301 PPLVAW 306
           PP+VAW
Sbjct: 301 PPMVAW 306


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241205750|ref|YP_002976846.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 303 Back     alignment and organism information
>gi|116253236|ref|YP_769074.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. viciae 3841] Length = 303 Back     alignment and organism information
>gi|190892790|ref|YP_001979332.1| coproporphyrinogen III oxidase [Rhizobium etli CIAT 652] Length = 303 Back     alignment and organism information
>gi|209550365|ref|YP_002282282.1| coproporphyrinogen III oxidase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 303 Back     alignment and organism information
>gi|325293608|ref|YP_004279472.1| Coproporphyrinogen III oxidase [Agrobacterium sp. H13-3] Length = 303 Back     alignment and organism information
>gi|327188341|gb|EGE55558.1| coproporphyrinogen III oxidase protein [Rhizobium etli CNPAF512] Length = 303 Back     alignment and organism information
>gi|222086615|ref|YP_002545149.1| coproporphyrinogen III oxidase protein [Agrobacterium radiobacter K84] Length = 303 Back     alignment and organism information
>gi|15889523|ref|NP_355204.1| coproporphyrinogen III oxidase [Agrobacterium tumefaciens str. C58] Length = 303 Back     alignment and organism information
>gi|150396759|ref|YP_001327226.1| coproporphyrinogen III oxidase [Sinorhizobium medicae WSM419] Length = 303 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target307 coproporphyrinogen III oxidase [Candidatus Liberibacter
PRK05330300 PRK05330, PRK05330, coproporphyrinogen III oxidase; Pro 1e-105
COG0408303 COG0408, HemF, Coproporphyrinogen III oxidase [Coenzyme 7e-92
KOG1518382 KOG1518, KOG1518, KOG1518, Coproporphyrinogen III oxida 1e-60
pfam01218296 pfam01218, Coprogen_oxidas, Coproporphyrinogen III oxid 2e-98
PLN02873274 PLN02873, PLN02873, coproporphyrinogen-III oxidase 5e-68
>gnl|CDD|180020 PRK05330, PRK05330, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|30757 COG0408, HemF, Coproporphyrinogen III oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|36731 KOG1518, KOG1518, KOG1518, Coproporphyrinogen III oxidase CPO/HEM13 [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|144711 pfam01218, Coprogen_oxidas, Coproporphyrinogen III oxidase Back     alignment and domain information
>gnl|CDD|178461 PLN02873, PLN02873, coproporphyrinogen-III oxidase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 307 coproporphyrinogen III oxidase [Candidatus Liberibacter
PRK05330297 coproporphyrinogen III oxidase; Provisional 100.0
pfam01218296 Coprogen_oxidas Coproporphyrinogen III oxidase. 100.0
COG0408303 HemF Coproporphyrinogen III oxidase [Coenzyme metabolis 100.0
KOG1518382 consensus 100.0
>PRK05330 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>pfam01218 Coprogen_oxidas Coproporphyrinogen III oxidase Back     alignment and domain information
>COG0408 HemF Coproporphyrinogen III oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG1518 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target307 coproporphyrinogen III oxidase [Candidatus Liberibacter
3dwr_A309 Leishmania Major Coproporphyrinogen Iii Oxidase Wit 7e-84
3e8j_A306 Coproporphyrinogen Iii Oxidase From Leishmania Naif 1e-83
3ejo_A310 Coproporphyrinogen Iii Oxidase From Leishmania Dono 5e-83
1vju_A309 Coproporphyrinogen Iii Oxidase From Leishmania Majo 1e-82
2aex_A346 The 1.58a Crystal Structure Of Human Coproporphyrin 1e-77
1tkl_A326 Yeast Oxygen-Dependent Coproporphyrinogen Oxidase L 3e-74
1txn_A328 Crystal Structure Of Coproporphyrinogen Iii Oxidase 3e-71
1tk1_A260 Yeast Oxygen-Dependent Coproporphyrinogen Oxidase L 3e-51
>gi|198443339|pdb|3DWR|A Chain A, Leishmania Major Coproporphyrinogen Iii Oxidase With Bound Ligand Length = 309 Back     alignment and structure
 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 106/294 (36%), Positives = 146/294 (49%), Gaps = 30/294 (10%)

Query: 19  RISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATL 78
              +     LQ  IC   E  + +A           F    W R+        GGR   +
Sbjct: 14  EAVKDFLLKLQDDICEALEAEDGQA----------TFVEDKWTREGGG-----GGRTRVM 58

Query: 79  CAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNI 138
             G V EK  V  S VYG   P    +         F A G+S+++HP NPHVP  H N+
Sbjct: 59  VDGAVIEKGGVNFSHVYGKGLPMSSTERHPDIAGCNFEAMGVSLVIHPKNPHVPTSHANV 118

Query: 139 RMIVTGA------YWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYK 192
           R+ V         +WFGGG DLTP      ++ + D   FH   +++C       Y  +K
Sbjct: 119 RLFVAEREGKEPVWWFGGGFDLTPY-----YAVEEDCRDFHQVAQDLCKPFGADVYARFK 173

Query: 193 EWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRN 252
            WCD YF++P+R E+RGIGG+FFD L+  P     +  F F+ AVG  ++  Y  +V R 
Sbjct: 174 GWCDEYFFIPYRNEARGIGGLFFDDLNEWP----FEKCFEFVQAVGKGYMDAYIPIVNRR 229

Query: 253 YHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
            +  ++EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 230 KNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 283


>gi|197725360|pdb|3E8J|A Chain A, Coproporphyrinogen Iii Oxidase From Leishmania Naiffi Length = 306 Back     alignment and structure
>gi|209447546|pdb|3EJO|A Chain A, Coproporphyrinogen Iii Oxidase From Leishmania Donovani Length = 310 Back     alignment and structure
>gi|48425926|pdb|1VJU|A Chain A, Coproporphyrinogen Iii Oxidase From Leishmania Major Length = 309 Back     alignment and structure
>gi|73536239|pdb|2AEX|A Chain A, The 1.58a Crystal Structure Of Human Coproporphyrinogen Oxidase Reveals The Structural Basis Of Hereditary Coproporphyria Length = 346 Back     alignment and structure
>gi|51247671|pdb|1TKL|A Chain A, Yeast Oxygen-Dependent Coproporphyrinogen Oxidase Length = 326 Back     alignment and structure
>gi|56966162|pdb|1TXN|A Chain A, Crystal Structure Of Coproporphyrinogen Iii Oxidase Length = 328 Back     alignment and structure
>gi|51247669|pdb|1TK1|A Chain A, Yeast Oxygen-Dependent Coproporphyrinogen Oxidase Length = 260 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target307 coproporphyrinogen III oxidase [Candidatus Liberibacter
2aex_A346 Coproporphyrinogen III oxidase, mitochondrial; FLAT bet 2e-71
1txn_A328 Coproporphyrinogen III oxidase; structural genomics, di 1e-66
1vju_A309 Coproporphyrinogen III oxidase; structural genomics, PS 1e-66
>2aex_A Coproporphyrinogen III oxidase, mitochondrial; FLAT beta-sheet sandwiched by helices, oxidoreductase; HET: CIT; 1.58A {Homo sapiens} Length = 346 Back     alignment and structure
 Score =  264 bits (675), Expect = 2e-71
 Identities = 112/313 (35%), Positives = 158/313 (50%), Gaps = 42/313 (13%)

Query: 12  DDIEERKRISQRKFE----NLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQK 67
            ++  R    + K E      Q+ +C    +++  A+          F+V  W     ++
Sbjct: 31  GELRRRPGDMKTKMELLILETQAQVCQALAQVDGGAN----------FSVDRW-----ER 75

Query: 68  EDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNP-------YFWATGL 120
           ++ GGG    L  G VFEKA V +S V+G+LS +   Q+    K          F A G+
Sbjct: 76  KEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGV 135

Query: 121 SVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRHSYDPDVIFFHN 174
           S ++HP NPH P +HFN R            +WFGGG DLTP+     +    D + FH 
Sbjct: 136 SSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPT-----YLNQEDAVHFHR 190

Query: 175 TLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFI 234
           TLKE C QH    Y  +K+WCD YF++ HR E RGIGGIFFD      +    +  F F+
Sbjct: 191 TLKEACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGIFFDD----LDSPSKEEVFRFV 246

Query: 235 SAVGDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNV 293
            +     +  Y  LV+++    F+ Q++  Q +RRGRY EFNLLYD+GT FG  T G  +
Sbjct: 247 QSCARAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRI 306

Query: 294 ESILASMPPLVAW 306
           ESIL S+P    W
Sbjct: 307 ESILMSLPLTARW 319


>1txn_A Coproporphyrinogen III oxidase; structural genomics, dimer, novel fold, PSI, protein structure initiative; 1.70A {Saccharomyces cerevisiae} SCOP: d.248.1.1 PDB: 1tkl_A 1tlb_A 1tk1_A Length = 328 Back     alignment and structure
>1vju_A Coproporphyrinogen III oxidase; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.40A {Leishmania major} SCOP: d.248.1.1 PDB: 2qt8_A* 3dwr_A 3dws_A* 3ejo_A 3e8j_A* Length = 309 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target307 coproporphyrinogen III oxidase [Candidatus Liberibacter
1vju_A309 Coproporphyrinogen III oxidase; structural genomics, PS 100.0
2aex_A346 Coproporphyrinogen III oxidase, mitochondrial; FLAT bet 100.0
1txn_A328 Coproporphyrinogen III oxidase; structural genomics, di 100.0
>1vju_A Coproporphyrinogen III oxidase; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.40A {Leishmania major} SCOP: d.248.1.1 PDB: 2qt8_A* 3dwr_A 3dws_A* 3ejo_A 3e8j_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=922.23  Aligned_cols=274  Identities=38%  Similarity=0.739  Sum_probs=262.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCCCEEEEEEECCCEEEEEEE
Q ss_conf             68766999999999999999999999999630102222344566512521231788888777504899505946536887
Q gi|254781073|r   10 CPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAV   89 (307)
Q Consensus        10 ~p~~ie~kk~~~~~wF~~LQd~Ic~~fE~lE~~~~~~~~~~~~~~F~~d~W~R~~g~~~~~GGG~s~VL~~G~VFEKaGV   89 (307)
                      .-.+|..+.+.+++||++||++||++||++|++          ++|++|.|+|++|     |||+||||++|+|||||||
T Consensus         5 ~~~~m~~~ie~Vk~~F~~LQ~~Ic~~lE~ldg~----------~~F~~d~W~R~~g-----GGG~t~Vl~~G~VfEKaGV   69 (309)
T 1vju_A            5 HHHHMSLAVEAVKDFLLKLQDDICEALEAEDGQ----------ATFVEDKWTREGG-----GGGRTRVMVDGAVIEKGGV   69 (309)
T ss_dssp             ---CCHHHHHHHHHHHHHHHHHHHHHHHHHHSS----------CCCEEEEEEETTT-----EEEEEEEEESCSSEEEEEE
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC----------CCEEECCCCCCCC-----CCCCEEEEECCEEEEECCE
T ss_conf             200043659999999999999999999964087----------8733545547875-----5541489866736750667


Q ss_pred             EEEEEECCCHHHHHHHHHHCCCCCCCEEECEEEEEECCCCCCCHHHCCHHHEEEC------CCCCCCCCCCCCCCCHHHC
Q ss_conf             7763003542677642111026765100000223313688744010230210202------4312532001100000110
Q gi|254781073|r   90 LVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSLESRRH  163 (307)
Q Consensus        90 NfS~V~G~~~p~~a~~i~g~~~~~~F~AtGiS~V~Hp~nP~vPt~H~N~R~f~~~------~~WFGGG~DLTP~~~~~~y  163 (307)
                      |||+|+|+++|+++.++++..++.+|||||||||+||+||+|||+|||+|||+|.      .||||||+|||||     |
T Consensus        70 N~S~V~G~~lp~~a~~~~~~~~~~~f~A~GiSlV~HP~NP~vPt~H~N~R~f~~~~~~~~~~wWFGGG~DLTP~-----y  144 (309)
T 1vju_A           70 NFSHVYGKGLPMSSTERHPDIAGCNFEAMGVSLVIHPKNPHVPTSHANVRLFVAEREGKEPVWWFGGGFDLTPY-----Y  144 (309)
T ss_dssp             EEEEEEEEC-----------CTTCEEEEEEEEEEEEESSTTSCEEEEEEEEEEEEETTEEEEEEEEEEEEEECS-----S
T ss_pred             EEEEEECCCCCHHHHHCCCCCCCCCCEEECCCCCEECCCCCCCCCCCCEEEEEEECCCCCCCEEEECCCCCHHH-----H
T ss_conf             79999666674234431654468751330243200368998862222469999825898653377134342054-----5


Q ss_pred             CCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEHHCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             43267999999998403656733428999976787434532521234301010147866658967799999999999999
Q gi|254781073|r  164 SYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIK  243 (307)
Q Consensus       164 ~~~eD~~~fH~~~k~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGvGGIFFD~l~~~~~~~~~e~~f~f~~~vg~~fl~  243 (307)
                      +++||+++||++||++||+|+++||++||||||+|||||||+|+|||||||||||++    ++++++|+|+++||++|++
T Consensus       145 ~~~eD~~~fH~~lK~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGiGGIFfD~l~~----~~~~~~f~f~~~vg~~fl~  220 (309)
T 1vju_A          145 AVEEDCRDFHQVAQDLCKPFGADVYARFKGWCDEYFFIPYRNEARGIGGLFFDDLNE----WPFEKCFEFVQAVGKGYMD  220 (309)
T ss_dssp             CCHHHHHHHHHHHHHHHGGGCTTHHHHHHHHHHHHSEEGGGTEESSSEEEEEEEECS----SCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCC----CCHHHHHHHHHHHHHHHHH
T ss_conf             308899999999998750123777799999867862030136676741566131147----9888879999999999999


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCHHHEEECCCCCCCCC
Q ss_conf             9999998754799998999885420240112211110255357357888111411288878897
Q gi|254781073|r  244 LYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP  307 (307)
Q Consensus       244 ~y~~Iv~~r~~~~~~~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL~t~gr~esIl~SlPp~~~Wp  307 (307)
                      +|+|||+||++++||++||+|||+||||||||||||||||+|||+||||||||||||||+|+|.
T Consensus       221 ~Y~~Iv~~r~~~~~t~~~k~~Ql~rRGRYvEFNL~yDRGT~FGL~tggr~esILmSlPp~a~W~  284 (309)
T 1vju_A          221 AYIPIVNRRKNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARWG  284 (309)
T ss_dssp             HHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHTTCCHHHHGGGSCSCCCCC
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHCCEEEEEEEEEECCCCCCCCCCCCHHHHEECCCCCCCCC
T ss_conf             8899999853799998899999972871489998777685002547995221012599768525



>2aex_A Coproporphyrinogen III oxidase, mitochondrial; FLAT beta-sheet sandwiched by helices, oxidoreductase; HET: CIT; 1.58A {Homo sapiens} Back     alignment and structure
>1txn_A Coproporphyrinogen III oxidase; structural genomics, dimer, novel fold, PSI, protein structure initiative; 1.70A {Saccharomyces cerevisiae} SCOP: d.248.1.1 PDB: 1tkl_A 1tlb_A 1tk1_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 307 coproporphyrinogen III oxidase [Candidatus Liberibacter
d1vjua_302 d.248.1.1 (A:) Hypothetical protein Lmaj006828 {Leishma 6e-69
d1tkla_325 d.248.1.1 (A:) Coproporphyrinogen III oxidase {Baker's 7e-66
>d1vjua_ d.248.1.1 (A:) Hypothetical protein Lmaj006828 {Leishmania major [TaxId: 5664]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Coproporphyrinogen III oxidase
superfamily: Coproporphyrinogen III oxidase
family: Coproporphyrinogen III oxidase
domain: Hypothetical protein Lmaj006828
species: Leishmania major [TaxId: 5664]
 Score =  254 bits (650), Expect = 6e-69
 Identities = 105/288 (36%), Positives = 141/288 (48%), Gaps = 30/288 (10%)

Query: 25  FENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVF 84
              LQ  IC   E  + +A           F    W      +E  GGGR   +  G V 
Sbjct: 13  LLKLQDDICEALEAEDGQAT----------FVEDKW-----TREGGGGGRTRVMVDGAVI 57

Query: 85  EKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVT- 143
           EK  V  S VYG   P    +         F A G+S+++HP NPHVP  H N+R+ V  
Sbjct: 58  EKGGVNFSHVYGKGLPMSSTERHPDIAGCNFEAMGVSLVIHPKNPHVPTSHANVRLFVAE 117

Query: 144 -----GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRY 198
                  +WFGGG DLTP               FH   +++C       Y  +K WCD Y
Sbjct: 118 REGKEPVWWFGGGFDLTPYYAVEEDC-----RDFHQVAQDLCKPFGADVYARFKGWCDEY 172

Query: 199 FYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPSLVRRNYHHLFS 258
           F++P+R E+RGIGG+FFD L+        +  F F+ AVG  ++  Y  +V R  +  ++
Sbjct: 173 FFIPYRNEARGIGGLFFDDLNE----WPFEKCFEFVQAVGKGYMDAYIPIVNRRKNTPYT 228

Query: 259 EQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAW 306
           EQ  + Q  RRGRYAEFNL+ D+GT FG ++GG  ESIL S+PP   W
Sbjct: 229 EQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARW 276


>d1tkla_ d.248.1.1 (A:) Coproporphyrinogen III oxidase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target307 coproporphyrinogen III oxidase [Candidatus Liberibacter
d1vjua_302 Hypothetical protein Lmaj006828 {Leishmania major [TaxI 100.0
d1tkla_325 Coproporphyrinogen III oxidase {Baker's yeast (Saccharo 100.0
>d1vjua_ d.248.1.1 (A:) Hypothetical protein Lmaj006828 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Coproporphyrinogen III oxidase
superfamily: Coproporphyrinogen III oxidase
family: Coproporphyrinogen III oxidase
domain: Hypothetical protein Lmaj006828
species: Leishmania major [TaxId: 5664]
Probab=100.00  E-value=0  Score=920.45  Aligned_cols=270  Identities=39%  Similarity=0.751  Sum_probs=259.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCCCEEEEEEECCCEEEEEEEEEEE
Q ss_conf             69999999999999999999999996301022223445665125212317888887775048995059465368877763
Q gi|254781073|r   14 IEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLVST   93 (307)
Q Consensus        14 ie~kk~~~~~wF~~LQd~Ic~~fE~lE~~~~~~~~~~~~~~F~~d~W~R~~g~~~~~GGG~s~VL~~G~VFEKaGVNfS~   93 (307)
                      |.++.+.+++||++||++||++||++|++          ++|++|.|+|++|     |||+||||++|+||||||||||+
T Consensus         2 m~~~ie~vk~~F~~LQ~~Ic~~lE~le~~----------~~F~~d~W~R~~G-----GGG~t~Vl~~G~VFEKaGVNfS~   66 (302)
T d1vjua_           2 MSLAVEAVKDFLLKLQDDICEALEAEDGQ----------ATFVEDKWTREGG-----GGGRTRVMVDGAVIEKGGVNFSH   66 (302)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHSS----------CCCEEEEEEETTT-----EEEEEEEEESCSSEEEEEEEEEE
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCC----------CCEEEECCCCCCC-----CCCEEEEEECCEEEEECCEEEEE
T ss_conf             76679999999999999999999964077----------8746604303799-----99748997078256644341799


Q ss_pred             EECCCHHHHHHHHHHCCCCCCCEEECEEEEEECCCCCCCHHHCCHHHEEECC------CCCCCCCCCCCCCCHHHCCCHH
Q ss_conf             0035426776421110267651000002233136887440102302102024------3125320011000001104326
Q gi|254781073|r   94 VYGDLSPDFKDQILGTTKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTGA------YWFGGGIDLTPSLESRRHSYDP  167 (307)
Q Consensus        94 V~G~~~p~~a~~i~g~~~~~~F~AtGiS~V~Hp~nP~vPt~H~N~R~f~~~~------~WFGGG~DLTP~~~~~~y~~~e  167 (307)
                      |+|+++|+++.++++..++.+|||||||||+||+||+|||+|||+|||+|.+      ||||||+|||||     |+++|
T Consensus        67 V~G~~lP~sa~~~~~~~~~~~f~AtGiSvV~HP~NP~vPt~H~N~R~f~~~~~~~~~~wWFGGG~DLTP~-----~~~~~  141 (302)
T d1vjua_          67 VYGKGLPMSSTERHPDIAGCNFEAMGVSLVIHPKNPHVPTSHANVRLFVAEREGKEPVWWFGGGFDLTPY-----YAVEE  141 (302)
T ss_dssp             EEEEC-----------CTTCEEEEEEEEEEEEESSTTSCEEEEEEEEEEEEETTEEEEEEEEEEEEEECS-----SCCHH
T ss_pred             EECCCCHHHHHHCCCCCCCCCEEEECCEEEEECCCCCCCCEEECEEEEEEECCCCCCEEEEECCCCCHHH-----HHHHH
T ss_conf             9854624444421654467740542100000126876761331314899844898621687055451166-----77699


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79999999984036567334289999767874345325212343010101478666589677999999999999999999
Q gi|254781073|r  168 DVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDCFIKLYPS  247 (307)
Q Consensus       168 D~~~fH~~~k~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGvGGIFFD~l~~~~~~~~~e~~f~f~~~vg~~fl~~y~~  247 (307)
                      |+++||++||++||+|+++||++||+|||+|||||||+|+|||||||||||++    .+++++|+|+++||++|+++|+|
T Consensus       142 D~~~fH~~~K~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGiGGIFfD~l~~----~~~~~~~~f~~~vg~~fl~~Y~~  217 (302)
T d1vjua_         142 DCRDFHQVAQDLCKPFGADVYARFKGWCDEYFFIPYRNEARGIGGLFFDDLNE----WPFEKCFEFVQAVGKGYMDAYIP  217 (302)
T ss_dssp             HHHHHHHHHHHHHGGGCTTHHHHHHHHHHHHSEEGGGTEESSSEEEEEEEECS----SCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHCCEEECCCCCCCCCCCEEEEEEECC----CCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999998626440012356765402046434212345533043420026----98788799999999999999999


Q ss_pred             HHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCHHHEEECCCCCCCCC
Q ss_conf             998754799998999885420240112211110255357357888111411288878897
Q gi|254781073|r  248 LVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASMPPLVAWP  307 (307)
Q Consensus       248 Iv~~r~~~~~~~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL~t~gr~esIl~SlPp~~~Wp  307 (307)
                      ||+||++++||++||+|||+||||||||||||||||+|||+||||||||||||||+|+|.
T Consensus       218 Iv~~r~~~~~~~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL~t~gr~esILmSlPp~~~W~  277 (302)
T d1vjua_         218 IVNRRKNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARWG  277 (302)
T ss_dssp             HHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHTTCCHHHHGGGSCSCCCCC
T ss_pred             HHHHHCCCCCCHHHHHHHHHHCCEEEEEEEEEECCCHHHCCCCCCHHEEEECCCCCCCCC
T ss_conf             999860799878999999985867689999975685020326996110022599768625



>d1tkla_ d.248.1.1 (A:) Coproporphyrinogen III oxidase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 307 coproporphyrinogen III oxidase [Candidatus Liberib
2aex_A_346 (A:) Coproporphyrinogen III oxidase, mitochondrial 6e-85
1vju_A_1-232232 (A:1-232) Coproporphyrinogen III oxidase; structur 2e-61
1txn_A_1-249249 (A:1-249) Coproporphyrinogen III oxidase; structur 2e-61
>2aex_A (A:) Coproporphyrinogen III oxidase, mitochondrial; FLAT beta-sheet sandwiched by helices, oxidoreductase; HET: CIT; 1.58A {Homo sapiens}Length = 346 Back     alignment and structure
 Score =  308 bits (790), Expect = 6e-85
 Identities = 112/310 (36%), Positives = 155/310 (50%), Gaps = 38/310 (12%)

Query: 11  PDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDL 70
                + K   +      Q+ +C    +++  A+          F+V  W     ++++ 
Sbjct: 34  RRRPGDMKTKMELLILETQAQVCQALAQVDGGAN----------FSVDRW-----ERKEG 78

Query: 71  GGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNP-------YFWATGLSVI 123
           GGG    L  G VFEKA V +S V+G+LS +   Q+    K          F A G+S +
Sbjct: 79  GGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSV 138

Query: 124 VHPYNPHVPAVHFNIRMIVT------GAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLK 177
           +HP NPH P +HFN R            +WFGGG DLTP+          D + FH TLK
Sbjct: 139 IHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYL-----NQEDAVHFHRTLK 193

Query: 178 EMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAV 237
           E C QH    Y  +K+WCD YF++ HR E RGIGGIFFD L S       +  F F+ + 
Sbjct: 194 EACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGIFFDDLDS----PSKEEVFRFVQSC 249

Query: 238 GDCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESI 296
               +  Y  LV+++    F+ Q++  Q +RRGRY EFNLLYD+GT FG  T G  +ESI
Sbjct: 250 ARAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESI 309

Query: 297 LASMPPLVAW 306
           L S+P    W
Sbjct: 310 LMSLPLTARW 319


>1vju_A (A:1-232) Coproporphyrinogen III oxidase; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.40A {Leishmania major}Length = 232 Back     alignment and structure
>1txn_A (A:1-249) Coproporphyrinogen III oxidase; structural genomics, dimer, novel fold, PSI, protein structure initiative; 1.70A {Saccharomyces cerevisiae}Length = 249 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target307 coproporphyrinogen III oxidase [Candidatus Liberibacter
2aex_A_346 Coproporphyrinogen III oxidase, mitochondrial; FLA 100.0
1vju_A_1-232232 Coproporphyrinogen III oxidase; structural genomic 100.0
1txn_A_1-249249 Coproporphyrinogen III oxidase; structural genomic 100.0
>2aex_A (A:) Coproporphyrinogen III oxidase, mitochondrial; FLAT beta-sheet sandwiched by helices, oxidoreductase; HET: CIT; 1.58A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=0  Score=919.90  Aligned_cols=271  Identities=41%  Similarity=0.768  Sum_probs=259.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCCCEEEEEEECCCEEEEEEEEE
Q ss_conf             76699999999999999999999999963010222234456651252123178888877750489950594653688777
Q gi|254781073|r   12 DDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHWLRDKSQKEDLGGGRMATLCAGKVFEKAAVLV   91 (307)
Q Consensus        12 ~~ie~kk~~~~~wF~~LQd~Ic~~fE~lE~~~~~~~~~~~~~~F~~d~W~R~~g~~~~~GGG~s~VL~~G~VFEKaGVNf   91 (307)
                      .+.+.++..+++||+.||++||++||+||++          ++|++|.|+|++|     |||+||||++|+|||||||||
T Consensus        35 ~~~~~~r~~~~~~~~~lQ~~Ic~~lE~idg~----------a~F~~d~W~R~~G-----GGG~s~Vl~~G~VFEKaGVN~   99 (346)
T 2aex_A           35 RRPGDMKTKMELLILETQAQVCQALAQVDGG----------ANFSVDRWERKEG-----GGGISCVLQDGCVFEKAGVSI   99 (346)
T ss_dssp             HCTTSHHHHHHHHHHHHHHHHHHHHHHHCTT----------CCCEEEEEEETTT-----EEEEEEEEESCSSEEEEEEEE
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC----------CCEEECCCCCCCC-----CCCEEEEEECCCEEEEEEEEE
T ss_conf             2838899999999999999999999987389----------9736446606899-----884289983892888621799


Q ss_pred             EEEECCCHHHHHHHHHHC-------CCCCCCEEECEEEEEECCCCCCCHHHCCHHHEEEC------CCCCCCCCCCCCCC
Q ss_conf             630035426776421110-------26765100000223313688744010230210202------43125320011000
Q gi|254781073|r   92 STVYGDLSPDFKDQILGT-------TKNPYFWATGLSVIVHPYNPHVPAVHFNIRMIVTG------AYWFGGGIDLTPSL  158 (307)
Q Consensus        92 S~V~G~~~p~~a~~i~g~-------~~~~~F~AtGiS~V~Hp~nP~vPt~H~N~R~f~~~------~~WFGGG~DLTP~~  158 (307)
                      |+|+|+++|++++++++.       ..+.+|||||||+|+||+||+|||+|||+|||++.      .||||||+||||| 
T Consensus       100 S~V~G~~~p~~a~~~~~~~~~~~~~~~~~~f~A~GiSlV~HP~NP~vPt~H~N~R~f~~~~~~~~~~~WFGGG~DLTP~-  178 (346)
T 2aex_A          100 SVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPT-  178 (346)
T ss_dssp             EEEEEECCHHHHHHHHHTTCCCCCBTTBCEEEEEEEEEEEEESSTTSCEEEEEEEEEEEECSTTCEEEEEEEEEEEECS-
T ss_pred             EEEEEECCHHHHHHHCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEEECCCCCCEEEEEEEECCCCC-
T ss_conf             9997417999997401133566542358853877545643116875530331035899856998722699764013333-


Q ss_pred             CHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEHHCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             00110432679999999984036567334289999767874345325212343010101478666589677999999999
Q gi|254781073|r  159 ESRRHSYDPDVIFFHNTLKEMCSQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVG  238 (307)
Q Consensus       159 ~~~~y~~~eD~~~fH~~~k~~Cd~~~~~~Y~~fKk~CD~YFylpHR~E~RGvGGIFFD~l~~~~~~~~~e~~f~f~~~vg  238 (307)
                          |+++||++|||+++|++||+|+++||++||+|||+|||||||+|+||||||||||||+    +++|++|+|+++||
T Consensus       179 ----y~~~eD~~~FH~~~K~aCd~~~~~~Y~~fK~wCD~YF~i~HR~E~RGiGGIFfDdl~~----~~~e~~f~F~~~~g  250 (346)
T 2aex_A          179 ----YLNQEDAVHFHRTLKEACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGIFFDDLDS----PSKEEVFRFVQSCA  250 (346)
T ss_dssp             ----SCCHHHHHHHHHHHHHHHHTTCTTHHHHHHHHHHHHTEEGGGTEESSSEEEEEEEECC----SCHHHHHHHHHHHH
T ss_pred             ----CCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCC----CCCCCHHHHHHHHH
T ss_conf             ----4768899999999999986418576799987653654234441245421367721378----86320079999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCC-CCCHHHEEECCCCCCCC
Q ss_conf             999999999998754799998999885420240112211110255357357-88811141128887889
Q gi|254781073|r  239 DCFIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKT-GGNVESILASMPPLVAW  306 (307)
Q Consensus       239 ~~fl~~y~~Iv~~r~~~~~~~~~k~~Ql~rRgRYvEFNL~yDRGT~FGL~t-~gr~esIl~SlPp~~~W  306 (307)
                      ++||++|+|||+||++++||++||+|||+||||||||||||||||+|||+| |||||||||||||+|+|
T Consensus       251 ~~fl~~Y~pIv~rr~~~~~te~er~~Ql~rRGRYvEFNLvyDRGT~FGL~t~G~r~esILmSLPp~a~W  319 (346)
T 2aex_A          251 RAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMSLPLTARW  319 (346)
T ss_dssp             HTHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHHCCCCTTGGGSSSCCHHHHHHHCCSCCCC
T ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCEEEEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCC
T ss_conf             999999999999860799988999989760887689998876685102637998810478648987801



>1vju_A (A:1-232) Coproporphyrinogen III oxidase; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.40A {Leishmania major} Back     alignment and structure
>1txn_A (A:1-249) Coproporphyrinogen III oxidase; structural genomics, dimer, novel fold, PSI, protein structure initiative; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure