254781074

254781074

uracil-DNA glycosylase

GeneID in NCBI database:8210098Locus tag:CLIBASIA_04880
Protein GI in NCBI database:254781074Protein Accession:YP_003065487.1
Gene range:+(1076001, 1076684)Protein Length:227aa
Gene description:uracil-DNA glycosylase
COG prediction:[L] Uracil DNA glycosylase
KEGG prediction:uracil-DNA glycosylase (EC:3.2.2.-); K03648 uracil-DNA glycosylase [EC:3.2.2.-]
SEED prediction:Uracil-DNA glycosylase, family 1
Pathway involved in KEGG:Base excision repair [PATH:las03410]
Subsystem involved in SEED:DNA Repair Base Excision;
Uracil-DNA glycosylase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHcEEEEEEcccccccccccEEEEEccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHcccccEEEEccccccccccccccccccHHHHHHHHHHccccccccccccc
cccEcccccHHHHHHHHHccHHHHHHHHHHHHHHHcccccEcccccccHHHHHcccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccHHHHcccEEEEEccccEEccEccccccccHHHHHHHHHHHHHHHccccEEEEEcHHHHHHcccccccccEEEEEcccccccHHHccccccHHHHHHHHHHHHcccccccccccc
MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEkrkgkrifprgshyfrafditpfnkVKVVILgqdpyhnygqahglcfsvplgirippsLVNVYKELqedvnfippthgflehwghEGVLLLNAVLTVEEgraashrgrgweqFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVlkaahpsplsashgffgcrHFSKANRYLQehgkttvnwqipls
MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRaashrgrgwEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQehgkttvnwqipls
MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS
***VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL*
MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS
*EGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ*P**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS
MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS
MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target227 uracil-DNA glycosylase [Candidatus Liberibacter asiatic
218682331233 uracil-DNA glycosylase [Rhizobium etli CIAT 894] Length 1 3e-84
294013125231 uracil-DNA glycosylase [Sphingobium japonicum UT26S] Le 1 6e-84
327190494233 uracil-DNA glycosylase protein [Rhizobium etli CNPAF512 1 9e-84
209550568235 uracil-DNA glycosylase [Rhizobium leguminosarum bv. tri 1 1e-83
190893069233 uracil-DNA glycosylase [Rhizobium etli CIAT 652] Length 1 3e-83
218513978224 uracil-DNA glycosylase [Rhizobium etli 8C-3] Length = 2 1 8e-83
307293772232 uracil-DNA glycosylase [Sphingobium chlorophenolicum L- 1 1e-82
222086867233 uracil-DNA glycosylase [Agrobacterium radiobacter K84] 1 7e-82
116253414235 uracil-DNA glycosylase [Rhizobium leguminosarum bv. vic 1 8e-82
25009525241 RecName: Full=Uracil-DNA glycosylase; Short=UDG Length 1 2e-81
>gi|218682331|ref|ZP_03529932.1| uracil-DNA glycosylase [Rhizobium etli CIAT 894] Length = 233 Back     alignment and organism information
 Score =  315 bits (807), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 179/223 (80%)

Query: 4   VKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVI 63
           V + ESWK+ L   F S +M+ LK FL+++K+ GKRIFPRGS YFRA D+TP + VKVVI
Sbjct: 6   VSLEESWKAALAGEFSSPYMQQLKAFLVAQKQVGKRIFPRGSEYFRALDLTPISNVKVVI 65

Query: 64  LGQDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLL 123
           LGQDPYH  GQAHGLCFSV  G+RIPPSLVN+YKE++ D+   P  HGFLEHW  +GVLL
Sbjct: 66  LGQDPYHGLGQAHGLCFSVRPGVRIPPSLVNIYKEMETDLGITPARHGFLEHWAKQGVLL 125

Query: 124 LNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHL 183
           LN+VLTVEEG+AA+H+G+GWE+FTD+VI  +++  +++VFMLWG+ AQ+K   +D  RHL
Sbjct: 126 LNSVLTVEEGQAATHQGKGWEKFTDAVIRKVNDECESVVFMLWGSYAQRKAAFVDTTRHL 185

Query: 184 VLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPL 226
           VLKA HPSPLSA +GFFGC HFSKAN +LQ  G+T V+WQ+P+
Sbjct: 186 VLKAPHPSPLSAHNGFFGCAHFSKANAFLQSRGRTPVDWQLPV 228


Species: Rhizobium etli
Genus: Rhizobium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|294013125|ref|YP_003546585.1| uracil-DNA glycosylase [Sphingobium japonicum UT26S] Length = 231 Back     alignment and organism information
>gi|327190494|gb|EGE57590.1| uracil-DNA glycosylase protein [Rhizobium etli CNPAF512] Length = 233 Back     alignment and organism information
>gi|209550568|ref|YP_002282485.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 235 Back     alignment and organism information
>gi|190893069|ref|YP_001979611.1| uracil-DNA glycosylase [Rhizobium etli CIAT 652] Length = 233 Back     alignment and organism information
>gi|218513978|ref|ZP_03510818.1| uracil-DNA glycosylase [Rhizobium etli 8C-3] Length = 224 Back     alignment and organism information
>gi|307293772|ref|ZP_07573616.1| uracil-DNA glycosylase [Sphingobium chlorophenolicum L-1] Length = 232 Back     alignment and organism information
>gi|222086867|ref|YP_002545401.1| uracil-DNA glycosylase [Agrobacterium radiobacter K84] Length = 233 Back     alignment and organism information
>gi|116253414|ref|YP_769252.1| uracil-DNA glycosylase [Rhizobium leguminosarum bv. viciae 3841] Length = 235 Back     alignment and organism information
>gi|25009525|sp|Q8UCM8|UNG_AGRT5 RecName: Full=Uracil-DNA glycosylase; Short=UDG Length = 241 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target227 uracil-DNA glycosylase [Candidatus Liberibacter asiatic
PRK05254224 PRK05254, PRK05254, uracil-DNA glycosylase; Provisional 1e-107
TIGR00628212 TIGR00628, ung, uracil-DNA glycosylase 4e-86
KOG2994297 KOG2994, KOG2994, KOG2994, Uracil DNA glycosylase [Repl 7e-78
PHA03200255 PHA03200, PHA03200, uracil DNA glycosylase; Provisional 7e-54
PHA03202313 PHA03202, PHA03202, uracil DNA glycosylase; Provisional 1e-49
PHA03199304 PHA03199, PHA03199, uracil DNA glycosylase; Provisional 4e-47
PHA03204322 PHA03204, PHA03204, uracil DNA glycosylase; Provisional 7e-44
PHA03201318 PHA03201, PHA03201, uracil DNA glycosylase; Provisional 4e-40
COG0692223 COG0692, Ung, Uracil DNA glycosylase [DNA replication, 2e-90
PHA03347252 PHA03347, PHA03347, uracil DNA glycosylase; Provisional 3e-58
pfam03167147 pfam03167, UDG, Uracil DNA glycosylase superfamily 1e-16
>gnl|CDD|179976 PRK05254, PRK05254, uracil-DNA glycosylase; Provisional Back     alignment and domain information
>gnl|CDD|161966 TIGR00628, ung, uracil-DNA glycosylase Back     alignment and domain information
>gnl|CDD|38205 KOG2994, KOG2994, KOG2994, Uracil DNA glycosylase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|165467 PHA03200, PHA03200, uracil DNA glycosylase; Provisional Back     alignment and domain information
>gnl|CDD|165469 PHA03202, PHA03202, uracil DNA glycosylase; Provisional Back     alignment and domain information
>gnl|CDD|165466 PHA03199, PHA03199, uracil DNA glycosylase; Provisional Back     alignment and domain information
>gnl|CDD|165471 PHA03204, PHA03204, uracil DNA glycosylase; Provisional Back     alignment and domain information
>gnl|CDD|165468 PHA03201, PHA03201, uracil DNA glycosylase; Provisional Back     alignment and domain information
>gnl|CDD|31036 COG0692, Ung, Uracil DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|177588 PHA03347, PHA03347, uracil DNA glycosylase; Provisional Back     alignment and domain information
>gnl|CDD|146005 pfam03167, UDG, Uracil DNA glycosylase superfamily Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 227 uracil-DNA glycosylase [Candidatus Liberibacter asiatic
TIGR00628225 ung uracil-DNA glycosylase; InterPro: IPR002043 Uracil- 100.0
PRK05254223 uracil-DNA glycosylase; Provisional 100.0
COG0692223 Ung Uracil DNA glycosylase [DNA replication, recombinat 100.0
KOG2994297 consensus 100.0
pfam03585 425 Herpes_ICP4_C Herpesvirus ICP4-like protein C-terminal 93.53
pfam03167147 UDG Uracil DNA glycosylase superfamily. 99.41
COG1573202 Uracil-DNA glycosylase [DNA replication, recombination, 92.89
>TIGR00628 ung uracil-DNA glycosylase; InterPro: IPR002043 Uracil-DNA glycosylase 3 Back     alignment and domain information
>PRK05254 uracil-DNA glycosylase; Provisional Back     alignment and domain information
>COG0692 Ung Uracil DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2994 consensus Back     alignment and domain information
>pfam03585 Herpes_ICP4_C Herpesvirus ICP4-like protein C-terminal region Back     alignment and domain information
>pfam03167 UDG Uracil DNA glycosylase superfamily Back     alignment and domain information
>COG1573 Uracil-DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target227 uracil-DNA glycosylase [Candidatus Liberibacter asiatic
2jhq_A226 Crystal Structure Of Uracil Dna-Glycosylase From Vi 3e-64
1eug_A229 Crystal Structure Of Escherichia Coli Uracil Dna Gl 1e-63
1eui_A228 Escherichia Coli Uracil-Dna Glycosylase Complex Wit 2e-63
1uug_A229 Escherichia Coli Uracil-Dna Glycosylase:inhibitor C 2e-63
2boo_A247 The Crystal Structure Of Uracil-Dna N-Glycosylase ( 1e-62
1flz_A228 Uracil Dna Glycosylase With Uaap Length = 228 2e-62
2eug_A229 Crystal Structure Of Escherichia Coli Uracil Dna Gl 2e-62
4eug_A229 Crystallographic And Enzymatic Studies Of An Active 4e-62
2uug_A229 Escherichia Coli Uracil-Dna Glycosylase:inhibitor C 6e-62
1okb_A223 Crystal Structure Of Uracil-Dna Glycosylase From At 2e-60
1yuo_A223 Optimisation Of The Surface Electrostatics As A Str 8e-60
1ugh_E223 Crystal Structure Of Human Uracil-Dna Glycosylase I 1e-59
2ssp_E223 Leucine-272-Alanine Uracil-Dna Glycosylase Bound To 6e-59
4skn_E223 A Nucleotide-Flipping Mechanism From The Structure 1e-58
3cxm_A268 Leishmania Naiffi Uracil-Dna Glycosylase In Complex 2e-52
2zhx_A238 Crystal Structure Of Uracil-Dna Glycosylase From My 1e-51
2j8x_A231 Epstein-Barr Virus Uracil-Dna Glycosylase In Comple 2e-44
1udi_E244 Nucleotide Mimicry In The Crystal Structure Of The 7e-43
2c53_A244 A Comparative Study Of Uracil Dna Glycosylases From 2e-41
2owq_A238 Crystal Structure Of Vaccinia Virus Uracil-Dna Glyc 2e-08
2owr_A218 Crystal Structure Of Vaccinia Virus Uracil-Dna Glyc 3e-08
gi|189339500|pdb|2JHQ|A Chain A, Crystal Structure Of Uracil Dna-Glycosylase From Vibrio Cholerae Length = 226 Back     alignment and structure
 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 114/216 (52%), Positives = 146/216 (67%), Gaps = 1/216 (0%)

Query: 9   SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDP 68
           +W  ++ N  Q  + +   +F+ S+++ GK I+P     F AF  T F  VKVVILGQDP
Sbjct: 6   TWHDVIGNEKQQAYFQQTLQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDP 65

Query: 69  YHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAV 127
           YH   QAHGLCFSV  G++ PPSLVN+YKEL +D+  F  P HG+L+ W  +GVLLLN V
Sbjct: 66  YHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPPHGYLQSWAQQGVLLLNTV 125

Query: 128 LTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLVLKA 187
           LTVE+G A SH   GWE FTD VID ++ +   ++F+LWG+ AQKK  ++D +RH VL A
Sbjct: 126 LTVEQGMAHSHANTGWETFTDRVIDALNQHRNGLIFLLWGSHAQKKGQMIDRQRHHVLMA 185

Query: 188 AHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
            HPSPLSA  GF GCRHFSK N+ LQ  G   +NWQ
Sbjct: 186 PHPSPLSAHRGFLGCRHFSKTNQLLQAQGIAPINWQ 221


gi|6435761|pdb|1EUG|A Chain A, Crystal Structure Of Escherichia Coli Uracil Dna Glycosylase And Its Complexes With Uracil And Glycerol: Structure And Glycosylase Mechanism Revisited Length = 229 Back     alignment and structure
>gi|5542225|pdb|1EUI|A Chain A, Escherichia Coli Uracil-Dna Glycosylase Complex With Uracil- Dna Glycosylase Inhibitor Protein Length = 228 Back     alignment and structure
gi|4699665|pdb|1UUG|A Chain A, Escherichia Coli Uracil-Dna Glycosylase:inhibitor Complex With Wild-Type Udg And Wild-Type Ugi Length = 229 Back     alignment and structure
gi|73536274|pdb|2BOO|A Chain A, The Crystal Structure Of Uracil-Dna N-Glycosylase (Ung) From Deinococcus Radiodurans. Length = 247 Back     alignment and structure
>gi|13096539|pdb|1FLZ|A Chain A, Uracil Dna Glycosylase With Uaap Length = 228 Back     alignment and structure
>gi|6435747|pdb|2EUG|A Chain A, Crystal Structure Of Escherichia Coli Uracil Dna Glycosylase And Its Complexes With Uracil And Glycerol: Structure And Glycosylase Mechanism Revisited Length = 229 Back     alignment and structure
>gi|5822568|pdb|4EUG|A Chain A, Crystallographic And Enzymatic Studies Of An Active Site Variant H187q Of Escherichia Coli Uracil Dna Glycosylase: Crystal Structures Of Mutant H187q And Its Uracil Complex Length = 229 Back     alignment and structure
>gi|4699671|pdb|2UUG|A Chain A, Escherichia Coli Uracil-Dna Glycosylase:inhibitor Complex With H187d Mutant Udg And Wild-Type Ugi Length = 229 Back     alignment and structure
>gi|48425132|pdb|1OKB|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Atlantic Cod (Gadus Morhua) Length = 223 Back     alignment and structure
>gi|61680820|pdb|1YUO|A Chain A, Optimisation Of The Surface Electrostatics As A Strategy For Cold Adaptation Of Uracil-Dna N-Glycosylase (Ung)from Atlantic Cod (Gadus Morhua) Length = 223 Back     alignment and structure
>gi|4558333|pdb|1UGH|E Chain E, Crystal Structure Of Human Uracil-Dna Glycosylase In Complex With A Protein Inhibitor: Protein Mimicry Of Dna Length = 223 Back     alignment and structure
>gi|5107736|pdb|2SSP|E Chain E, Leucine-272-Alanine Uracil-Dna Glycosylase Bound To Abasic Site-Containing Dna Length = 223 Back     alignment and structure
>gi|4558005|pdb|4SKN|E Chain E, A Nucleotide-Flipping Mechanism From The Structure Of Human Uracil-Dna Glycosylase Bound To Dna Length = 223 Back     alignment and structure
>gi|187609425|pdb|3CXM|A Chain A, Leishmania Naiffi Uracil-Dna Glycosylase In Complex With 5- Bromouracil Length = 268 Back     alignment and structure
>gi|188595925|pdb|2ZHX|A Chain A, Crystal Structure Of Uracil-Dna Glycosylase From Mycobacterium Tuberculosis In Complex With A Proteinaceous Inhibitor Length = 238 Back     alignment and structure
>gi|122920847|pdb|2J8X|A Chain A, Epstein-Barr Virus Uracil-Dna Glycosylase In Complex With Ugi From Pbs-2 Length = 231 Back     alignment and structure
>gi|1431680|pdb|1UDI|E Chain E, Nucleotide Mimicry In The Crystal Structure Of The Uracil- Dna Glycosylase-Uracil Glycosylase Inhibitor Protein Complex Length = 244 Back     alignment and structure
>gi|83754649|pdb|2C53|A Chain A, A Comparative Study Of Uracil Dna Glycosylases From Human And Herpes Simplex Virus Type 1 Length = 244 Back     alignment and structure
>gi|157835582|pdb|2OWQ|A Chain A, Crystal Structure Of Vaccinia Virus Uracil-Dna Glycosylase Length = 238 Back     alignment and structure
>gi|157835584|pdb|2OWR|A Chain A, Crystal Structure Of Vaccinia Virus Uracil-Dna Glycosylase Length = 218 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target227 uracil-DNA glycosylase [Candidatus Liberibacter asiatic
3a7n_A238 UDG, uracil-DNA glycosylase; UNG-UGI interactions, UNG- 3e-81
3cxm_A268 Uracil-DNA glycosylase; base excision repair, BER, DNA 2e-68
3fci_A223 UDG, uracil-DNA glycosylase; DNA repair, alternative sp 3e-68
2zhx_A238 UDG, uracil-DNA glycosylase; DNA repair, UNG-UGI comple 8e-68
4eug_A229 UDG, UNG, protein (glycosylase); 1.40A {Escherichia col 3e-67
2boo_A247 UDG, uracil-DNA glycosylase; UNG, base excision repair, 3e-67
1udg_A244 Uracil-DNA glycosylase; hydrolase; 1.75A {Herpes simple 1e-61
2j8x_A231 Uracil-DNA glycosylase; hydrolase/inhibitor, hydrolase/ 4e-61
2owr_A218 UDG, uracil-DNA glycosylase; uracil-DNA glycosylase fol 4e-51
>3a7n_A UDG, uracil-DNA glycosylase; UNG-UGI interactions, UNG-DNA complex, citrate AS protein LI ligand binding, inhibitor design; HET: FLC; 1.95A {Mycobacterium tuberculosis H37RV} PDB: 2zhx_A* Length = 238 Back     alignment and structure
 Score =  296 bits (758), Expect = 3e-81
 Identities = 89/221 (40%), Positives = 128/221 (57%), Gaps = 4/221 (1%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
           +   W + LE    ++ + ++ +FL +E   G+R  P GS+  RAF   PF+ V+V+I+G
Sbjct: 21  VERGWAAALE--PVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFT-FPFDNVRVLIVG 77

Query: 66  QDPYHNYGQAHGLCFSVPLGIR-IPPSLVNVYKELQEDVNFIPPTHGFLEHWGHEGVLLL 124
           QDPY   G A GL FSV   +R  P SL N++ E   D+ +  P++G L  W   GVLLL
Sbjct: 78  QDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLL 137

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           N VLTV     ASHRG+GWE  T+  I  ++     +V +LWG  A   + +L     + 
Sbjct: 138 NRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVA 197

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIP 225
           +++ HPSPLSAS GFFG R FS+AN  L   G   ++W++P
Sbjct: 198 IESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 238


>3cxm_A Uracil-DNA glycosylase; base excision repair, BER, DNA damage repair, MSGPP, SGPP, hydrolase, 5-bromouracil, structural genomics; 1.50A {Leishmania naiffi} Length = 268 Back     alignment and structure
>3fci_A UDG, uracil-DNA glycosylase; DNA repair, alternative splicing, disease mutation, DNA damage, glycosidase, HOST- virus interaction, hydrolase; HET: 3FI; 1.27A {Homo sapiens} PDB: 1emh_A* 1emj_A* 1q3f_A* 1ssp_E* 1ugh_E 1akz_A* 2oxm_A* 2oyt_A* 3fcf_A* 2hxm_A* 3fck_B* 3fcl_A* 2ssp_E* 1yuo_A 4skn_E* 1okb_A Length = 223 Back     alignment and structure
>2zhx_A UDG, uracil-DNA glycosylase; DNA repair, UNG-UGI complex, UNG-DNA interactions, cytoplasm, DNA damage; 3.10A {Mycobacterium tuberculosis} Length = 238 Back     alignment and structure
>4eug_A UDG, UNG, protein (glycosylase); 1.40A {Escherichia coli} SCOP: c.18.1.1 PDB: 5eug_A 1eug_A 2uug_A 3eug_A 2eug_A 1uug_A 1lqj_A 1lqm_A 1lqg_A 1flz_A 1eui_A 2jhq_A Length = 229 Back     alignment and structure
>2boo_A UDG, uracil-DNA glycosylase; UNG, base excision repair, radiation resistance, DNA damage, DNA repair, glycosidase, hydrolase; 1.8A {Deinococcus radiodurans} Length = 247 Back     alignment and structure
>1udg_A Uracil-DNA glycosylase; hydrolase; 1.75A {Herpes simplex virus} SCOP: c.18.1.1 PDB: 1lau_E 1udh_A 1udi_E 2c53_A* 2c56_A* Length = 244 Back     alignment and structure
>2j8x_A Uracil-DNA glycosylase; hydrolase/inhibitor, hydrolase/inhibitor complex, EBV, DNA repair, lytic protein, epstein-BARR virus; 2.3A {Epstein-barr virus} SCOP: c.18.1.1 Length = 231 Back     alignment and structure
>2owr_A UDG, uracil-DNA glycosylase; uracil-DNA glycosylase fold in the core: 3 layers (A/B/A); HET: EPE; 2.30A {Vaccinia virus} PDB: 2owq_A Length = 218 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target227 uracil-DNA glycosylase [Candidatus Liberibacter asiatic
3cxm_A268 Uracil-DNA glycosylase; base excision repair, BER, DNA 100.0
2boo_A247 UDG, uracil-DNA glycosylase; UNG, base excision repair, 100.0
3a7n_A238 UDG, uracil-DNA glycosylase; UNG-UGI interactions, UNG- 100.0
4eug_A229 UDG, UNG, protein (glycosylase); hydrolase; 1.40A {Esch 100.0
3fci_A223 UDG, uracil-DNA glycosylase; DNA repair, alternative sp 100.0
1udg_A244 Uracil-DNA glycosylase; hydrolase; 1.75A {Herpes simple 100.0
2j8x_A231 Uracil-DNA glycosylase; hydrolase/inhibitor, hydrolase/ 100.0
2owr_A218 UDG, uracil-DNA glycosylase; uracil-DNA glycosylase fol 100.0
1oe4_A247 SMUG1, single-strand selective monofunctional uracil DN 96.72
1mug_A168 Protein (G:T/U specific DNA glycosylase); hydrolase; 1. 95.74
1wyw_A230 TDG, G/T mismatch-specific thymine DNA glycosylase; hyd 95.73
1vk2_A204 Uracil-DNA glycosylase TM0511; structural genomics, JCS 91.18
>3cxm_A Uracil-DNA glycosylase; base excision repair, BER, DNA damage repair, MSGPP, SGPP, hydrolase, 5-bromouracil, structural genomics; 1.50A {Leishmania naiffi} Back     alignment and structure
Probab=100.00  E-value=0  Score=614.15  Aligned_cols=227  Identities=47%  Similarity=0.920  Sum_probs=216.7

Q ss_pred             CCCCCCCHHHHHHHH----HHHCCHHHHHHHHHHHHHHHCCCEECCCHHHHHHHHHCCCHHHCEEEEEECCCCCCCCCCC
Q ss_conf             986868733899988----8726589999999999999779808588769999984299861779998118887752000
Q gi|254781074|r    1 MEGVKIHESWKSLLE----NHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAH   76 (227)
Q Consensus         1 l~~l~i~~sW~~~L~----~e~~~~~~~~i~~~l~~e~~~~~~i~P~~~~IF~af~~~p~~~vKVVIlGQDPY~~~g~A~   76 (227)
                      +..+-++++|+++|+    +++.++||.+|.+||.+|+.++++|||+.++|||||++||+++||||||||||||++|||+
T Consensus        31 ~~~~~~dp~W~~~L~p~~~~~~~k~~f~~l~~fl~~e~~~~~~i~P~~~~IF~af~~~p~~~vKVVIlGQDPYh~~gqA~  110 (268)
T 3cxm_A           31 LAGLITNPEWRDFLAPITADSWRKGAFIRIERFLDEEKEKGRVILPPAADIFNAFNSCPFRGLKVVLLGQDPYHDLHQAH  110 (268)
T ss_dssp             TGGGCCCHHHHHHHHHHHSTTTTTTHHHHHHHHHHHHHHTTCCEESCGGGTTHHHHTSCSTTCCEEEEESSCCCSTTTCC
T ss_pred             HHHCCCCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHCCCEECCCHHHHHHHHHCCCHHHCEEEEEECCCCCCCCCCC
T ss_conf             66566894599998663305230299999999999999869977698799999886089879379997427998999710


Q ss_pred             CCEEECCCCCCCHHHHHHHHHHHHHHC-CCCCCCCCHHHHHHCCCEEEECCHHCCCCCCCHHHHHC-CHHHHHHHHHHHH
Q ss_conf             710003479863046999999999741-88887740124322089688601011236860445432-5999999999999
Q gi|254781074|r   77 GLCFSVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGR-GWEQFTDSVIDLI  154 (227)
Q Consensus        77 GLaFsv~~~~~~p~SLrNI~Kel~~d~-~~~~~~~g~L~~Wa~QGVLLLNt~LTv~~g~~~SH~~~-gW~~ft~~ii~~l  154 (227)
                      ||||||++++++|||||||||||.+|+ ++..+.+|||+.||+||||||||+|||++|+++||+++ ||++||+.||++|
T Consensus       111 GLaFSv~~~~k~PpSLrNI~KeL~~d~~~~~~p~~g~L~~Wa~QGVLLLNt~LTv~~g~~~SH~~~~GWe~fT~~vI~~i  190 (268)
T 3cxm_A          111 GLCFSVLPEVPLPPSLRNIYKELTTDIAGFQAPKHGYLQSWSEQGMLMLNATLTVEAHKANSHSKTSGWAAFTDAVIQHL  190 (268)
T ss_dssp             SSTTCCCTTSCCCHHHHHHHHHHHHHSTTCCCCSSCCCHHHHTTTEEEEESSCCEETTCTTTTTTTSCHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             68654899999981599999999975288889998526889849858873248887787343578877899999999999


Q ss_pred             HCCCC-CEEEEEECCHHHHHHHCCCCCCCEEEEECCCCHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             61789-87999975323334420576660799847888222578862787089999999987889746508898
Q gi|254781074|r  155 SNNHQ-NIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS  227 (227)
Q Consensus       155 ~~~~~-~vVfiLwG~~A~~~~~~i~~~~~~il~~~HPSPls~~~gF~~~~~F~~~N~~L~~~~~~~IdW~lp~~  227 (227)
                      +++++ ++||||||++||+++.+|+.++|+||+++|||||||+||||||+||++||+||+++|++||||+||++
T Consensus       191 ~~~~~~~vVflLWG~~Aq~~~~~i~~~~h~Il~s~HPSPLSa~rgF~g~~~Fsk~N~~L~~~g~~pIdW~lp~~  264 (268)
T 3cxm_A          191 SQHHPNRLVFLLWGGYAQQKKRLIDANRHVVLENVHPSPLSANRGWFGCRCFSACNEALQRMSHLPMHWQLPLN  264 (268)
T ss_dssp             HHHCSSCCEEEEESHHHHGGGGGSCTTTSEEEEECCSSHHHHTTTTTTCCHHHHHHHHHHHTTCCCCCCCCCSS
T ss_pred             HHCCCCCEEEEEECHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEECCCCCC
T ss_conf             85277887999717589998842898786699757999734467988887689999999977999872228998



>2boo_A UDG, uracil-DNA glycosylase; UNG, base excision repair, radiation resistance, DNA damage, DNA repair, glycosidase, hydrolase; 1.8A {Deinococcus radiodurans} Back     alignment and structure
>3a7n_A UDG, uracil-DNA glycosylase; UNG-UGI interactions, UNG-DNA complex, citrate AS protein LI ligand binding, inhibitor design; HET: FLC; 1.95A {Mycobacterium tuberculosis H37RV} PDB: 2zhx_A* Back     alignment and structure
>4eug_A UDG, UNG, protein (glycosylase); hydrolase; 1.40A {Escherichia coli B} SCOP: c.18.1.1 PDB: 5eug_A 1eug_A 2uug_A 3eug_A 2eug_A 1uug_A 1lqj_A 1lqm_A 1lqg_A 1flz_A 1eui_A 2jhq_A Back     alignment and structure
>3fci_A UDG, uracil-DNA glycosylase; DNA repair, alternative splicing, disease mutation, DNA damage, glycosidase, HOST- virus interaction, hydrolase; HET: 3FI; 1.27A {Homo sapiens} PDB: 1emh_A* 1emj_A* 1q3f_A* 1ssp_E* 1ugh_E 1akz_A* 2oxm_A* 2oyt_A* 3fcf_A* 2hxm_A* 3fck_B* 3fcl_A* 2ssp_E* 1yuo_A 4skn_E* 1okb_A Back     alignment and structure
>1udg_A Uracil-DNA glycosylase; hydrolase; 1.75A {Herpes simplex virus} SCOP: c.18.1.1 PDB: 1lau_E 1udh_A 1udi_E 2c53_A* 2c56_A* Back     alignment and structure
>2j8x_A Uracil-DNA glycosylase; hydrolase/inhibitor, hydrolase/inhibitor complex, EBV, DNA repair, lytic protein, epstein-BARR virus; 2.3A {Epstein-barr virus} SCOP: c.18.1.1 Back     alignment and structure
>2owr_A UDG, uracil-DNA glycosylase; uracil-DNA glycosylase fold in the core: 3 layers (A/B/A); HET: EPE; 2.30A {Vaccinia virus} PDB: 2owq_A Back     alignment and structure
>1oe4_A SMUG1, single-strand selective monofunctional uracil DNA glycosylase; hydrolase, hydrolase/complex, SMUG1; HET: 3DR; 2.0A {Xenopus laevis} SCOP: c.18.1.3 PDB: 1oe5_A* 1oe6_A* Back     alignment and structure
>1mug_A Protein (G:T/U specific DNA glycosylase); hydrolase; 1.80A {Escherichia coli} SCOP: c.18.1.2 PDB: 1mtl_A 1mwi_A* 1mwj_A Back     alignment and structure
>1wyw_A TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens} SCOP: c.18.1.2 PDB: 2d07_A 2rba_A* Back     alignment and structure
>1vk2_A Uracil-DNA glycosylase TM0511; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics, hydrolase; 1.90A {Thermotoga maritima} SCOP: c.18.1.2 PDB: 1l9g_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 227 uracil-DNA glycosylase [Candidatus Liberibacter asiatic
d2hxma1223 c.18.1.1 (A:82-304) Uracil-DNA glycosylase {Human (Homo 4e-68
d3euga_225 c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli 8e-68
d2j8xa1230 c.18.1.1 (A:26-255) Uracil-DNA glycosylase {Epstein-Bar 7e-61
d1laue_228 c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex vi 5e-60
>d2hxma1 c.18.1.1 (A:82-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Uracil-DNA glycosylase-like
superfamily: Uracil-DNA glycosylase-like
family: Uracil-DNA glycosylase
domain: Uracil-DNA glycosylase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  251 bits (642), Expect = 4e-68
 Identities = 112/219 (51%), Positives = 137/219 (62%), Gaps = 2/219 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
             ESWK  L   F   +   L  F+  E RK   ++P     F    +     VKVVILG
Sbjct: 4   FGESWKKHLSGEFGKPYFIKLMGFVAEE-RKHYTVYPPPHQVFTWTQMCDIKDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLL 124
           QDPYH   QAHGLCFSV   +  PPSL N+YKEL  D+  F+ P HG L  W  +GVLLL
Sbjct: 63  QDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLL 122

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NAVLTV   +A SH+ RGWEQFTD+V+  ++ N   +VF+LWG+ AQKK   +D KRH V
Sbjct: 123 NAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHV 182

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQ 223
           L+ AHPSPLS   GFFGCRHFSK N  LQ+ GK  ++W+
Sbjct: 183 LQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK 221


>d3euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d2j8xa1 c.18.1.1 (A:26-255) Uracil-DNA glycosylase {Epstein-Barr virus [TaxId: 10376]} Length = 230 Back     information, alignment and structure
>d1laue_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1 [TaxId: 10298]} Length = 228 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target227 uracil-DNA glycosylase [Candidatus Liberibacter asiatic
d3euga_225 Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]} 100.0
d2hxma1223 Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 96 100.0
d1laue_228 Uracil-DNA glycosylase {Herpes simplex virus type 1 [Ta 100.0
d2j8xa1230 Uracil-DNA glycosylase {Epstein-Barr virus [TaxId: 1037 100.0
d1oe4a_245 Single-strand selective monofunctional uracil-DNA glyco 96.68
d1muga_165 G:T/U mismatch-specific DNA glycosylase, Mug {Escherich 94.53
d1vk2a_191 Thermophilic uracil-DNA glycosylase {Thermotoga maritim 90.15
>d3euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Uracil-DNA glycosylase-like
superfamily: Uracil-DNA glycosylase-like
family: Uracil-DNA glycosylase
domain: Uracil-DNA glycosylase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=596.62  Aligned_cols=218  Identities=53%  Similarity=0.981  Sum_probs=211.9

Q ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHCCCEECCCHHHHHHHHHCCCHHHCEEEEEECCCCCCCCCCCCCEEECCCCCCC
Q ss_conf             38999888726589999999999999779808588769999984299861779998118887752000710003479863
Q gi|254781074|r    9 SWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCFSVPLGIRI   88 (227)
Q Consensus         9 sW~~~L~~e~~~~~~~~i~~~l~~e~~~~~~i~P~~~~IF~af~~~p~~~vKVVIlGQDPY~~~g~A~GLaFsv~~~~~~   88 (227)
                      +|+++|.+|+.++||.+|.++|.+|+.++.+|||+.++|||||++||+++||||||||||||++|||+||||||++++++
T Consensus         2 sW~~~l~~e~~~~yf~~l~~~l~~e~~~~~~i~P~~~~IF~af~~~~~~~vKVVIlGQDPYh~~~~A~GLaFsv~~~~~~   81 (225)
T d3euga_           2 TWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIAI   81 (225)
T ss_dssp             CHHHHHTTGGGSHHHHHHHHHHHHHHHTTCCEESCGGGTTHHHHHSCGGGCCEEEEESSCCCSTTTCSSSTTCCCTTSCC
T ss_pred             CHHHHHHHHHCCHHHHHHHHHHHHHHHCCCEECCCHHHHHHHHHCCCHHHCEEEEEECCCCCCCCCEEEEEEECCCCCCC
T ss_conf             82899998976799999999999999859956798789999987069757569999657887555113641331589888


Q ss_pred             HHHHHHHHHHHHHHC-CCCCCCCCHHHHHHCCCEEEECCHHCCCCCCCHHHHHCCHHHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             046999999999741-8888774012432208968860101123686044543259999999999996178987999975
Q gi|254781074|r   89 PPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWG  167 (227)
Q Consensus        89 p~SLrNI~Kel~~d~-~~~~~~~g~L~~Wa~QGVLLLNt~LTv~~g~~~SH~~~gW~~ft~~ii~~l~~~~~~vVfiLwG  167 (227)
                      |||||||||||++|+ ++..+.+|||+.||+|||||||++|||++|+|+||+++||++||+.+|++|+++++++||||||
T Consensus        82 PpSL~NI~kel~~d~~~~~~~~~g~L~~Wa~QGVLLLN~~LTv~~g~~~SH~~~GWe~ft~~ii~~l~~~~~~vvfiLwG  161 (225)
T d3euga_          82 PPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWG  161 (225)
T ss_dssp             CHHHHHHHHHHHHHSTTCCCCSCCCCHHHHTTTEEEEESSCCEETTBTTTTTTSSHHHHHHHHHHHHHHHCSSCEEEEES
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCEEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             83499999999986389878999852035417657774359998575666211158999999999997367785999861


Q ss_pred             CHHHHHHHCCCCCCCEEEEECCCCHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCC--CCCC
Q ss_conf             3233344205766607998478882225788627870899999999878897465--0889
Q gi|254781074|r  168 ASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNW--QIPL  226 (227)
Q Consensus       168 ~~A~~~~~~i~~~~~~il~~~HPSPls~~~gF~~~~~F~~~N~~L~~~~~~~IdW--~lp~  226 (227)
                      ++||+++.+|+.++|+||+++|||||||+||||||+||++||++|+++|++||||  .||.
T Consensus       162 ~~A~~~~~~i~~~~h~il~s~HPSPlsa~rgF~g~~~F~k~N~~L~~~~~~pIdW~~~~~~  222 (225)
T d3euga_         162 SHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPA  222 (225)
T ss_dssp             HHHHHHTTTSCTTTSEEEEECCSSTTTGGGTTTTCCHHHHHHHHHHHTTCCCCCCSCCCCC
T ss_pred             EHHHHHHHHHCCCCCEEEEECCCCHHHCCCCCCCCCHHHHHHHHHHHCCCCCEECCCCCCC
T ss_conf             3066777651567876998279982214899878977999999999869998658887977



>d2hxma1 c.18.1.1 (A:82-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1laue_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1 [TaxId: 10298]} Back     information, alignment and structure
>d2j8xa1 c.18.1.1 (A:26-255) Uracil-DNA glycosylase {Epstein-Barr virus [TaxId: 10376]} Back     information, alignment and structure
>d1oe4a_ c.18.1.3 (A:) Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1muga_ c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase, Mug {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vk2a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 227 uracil-DNA glycosylase [Candidatus Liberibacter as
3fci_A_223 (A:) UDG, uracil-DNA glycosylase; DNA repair, alte 2e-81
2boo_A_247 (A:) UDG, uracil-DNA glycosylase; UNG, base excisi 4e-81
2zhx_A_238 (A:) UDG, uracil-DNA glycosylase; DNA repair, UNG- 3e-80
4eug_A_45-229185 (A:45-229) UDG, UNG, protein (glycosylase); 1.40A 4e-72
1udg_A_70-244175 (A:70-244) Uracil-DNA glycosylase; hydrolase; 1.75 2e-67
3cxm_A_83-268186 (A:83-268) Uracil-DNA glycosylase; base excision r 4e-67
2j8x_A_48-231184 (A:48-231) Uracil-DNA glycosylase; hydrolase/inhib 1e-66
2owr_A_48-218171 (A:48-218) UDG, uracil-DNA glycosylase; uracil-DNA 1e-54
3fho_A_1-326326 (A:1-326) ATP-dependent RNA helicase DBP5; mRNA ex 9e-05
>3fci_A (A:) UDG, uracil-DNA glycosylase; DNA repair, alternative splicing, disease mutation, DNA damage, glycosidase, HOST- virus interaction, hydrolase; HET: 3FI; 1.27A {Homo sapiens} PDB: 1emh_A* 1emj_A* 1q3f_A* 1ssp_E* 1ugh_E 1akz_A* 2oxm_A* 2oyt_A* 3fcf_A* 2hxm_A* 3fck_B* 3fcl_A* 2ssp_E* 1yuo_A 4skn_E* 1okb_ALength = 223 Back     alignment and structure
 Score =  296 bits (759), Expect = 2e-81
 Identities = 112/220 (50%), Positives = 137/220 (62%), Gaps = 2/220 (0%)

Query: 6   IHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILG 65
             ESWK  L   F   +   L  F+  E RK   ++P     F    +     VKVVILG
Sbjct: 4   FGESWKKHLSGEFGKPYFIKLMGFVAEE-RKHYTVYPPPHQVFTWTQMCDIKDVKVVILG 62

Query: 66  QDPYHNYGQAHGLCFSVPLGIRIPPSLVNVYKELQEDVN-FIPPTHGFLEHWGHEGVLLL 124
           QDPYH   QAHGLCFSV   +  PPSL N+YKEL  D+  F+ P HG L  W  +GVLLL
Sbjct: 63  QDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLL 122

Query: 125 NAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQNIVFMLWGASAQKKQDVLDHKRHLV 184
           NAVLTV   +A SH+ RGWEQFTD+V+  ++ N   +VF+LWG+ AQKK   +D KRH V
Sbjct: 123 NAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHV 182

Query: 185 LKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQI 224
           L+ AHPSPLS   GFFGCRHFSK N  LQ+ GK  ++W+ 
Sbjct: 183 LQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKE 222


>2boo_A (A:) UDG, uracil-DNA glycosylase; UNG, base excision repair, radiation resistance, DNA damage, DNA repair, glycosidase, hydrolase; 1.8A {Deinococcus radiodurans}Length = 247 Back     alignment and structure
>2zhx_A (A:) UDG, uracil-DNA glycosylase; DNA repair, UNG-UGI complex, UNG-DNA interactions, cytoplasm, DNA damage; 3.10A {Mycobacterium tuberculosis}Length = 238 Back     alignment and structure
>4eug_A (A:45-229) UDG, UNG, protein (glycosylase); 1.40A {Escherichia coli}Length = 185 Back     alignment and structure
>1udg_A (A:70-244) Uracil-DNA glycosylase; hydrolase; 1.75A {Herpes simplex virus}Length = 175 Back     alignment and structure
>3cxm_A (A:83-268) Uracil-DNA glycosylase; base excision repair, BER, DNA damage repair, MSGPP, SGPP, hydrolase, 5-bromouracil, structural genomics; 1.50A {Leishmania naiffi}Length = 186 Back     alignment and structure
>2j8x_A (A:48-231) Uracil-DNA glycosylase; hydrolase/inhibitor, hydrolase/inhibitor complex, EBV, DNA repair, lytic protein, epstein-BARR virus; 2.3A {Epstein-barr virus}Length = 184 Back     alignment and structure
>2owr_A (A:48-218) UDG, uracil-DNA glycosylase; uracil-DNA glycosylase fold in the core: 3 layers (A/B/A); HET: EPE; 2.30A {Vaccinia virus} PDB: 2owq_ALength = 171 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target227 uracil-DNA glycosylase [Candidatus Liberibacter asiatic
2boo_A_247 UDG, uracil-DNA glycosylase; UNG, base excision re 100.0
2zhx_A_238 UDG, uracil-DNA glycosylase; DNA repair, UNG-UGI c 100.0
3fci_A_223 UDG, uracil-DNA glycosylase; DNA repair, alternati 100.0
4eug_A_45-229185 UDG, UNG, protein (glycosylase); 1.40A {Escherichi 100.0
2j8x_A_48-231184 Uracil-DNA glycosylase; hydrolase/inhibitor, hydro 100.0
3cxm_A_83-268186 Uracil-DNA glycosylase; base excision repair, BER, 100.0
1udg_A_70-244175 Uracil-DNA glycosylase; hydrolase; 1.75A {Herpes s 100.0
2owr_A_48-218171 UDG, uracil-DNA glycosylase; uracil-DNA glycosylas 100.0
1wyw_A_1-199199 TDG, G/T mismatch-specific thymine DNA glycosylase 95.47
1ui0_A_205 Uracil-DNA glycosylase; base excision repair, iron 91.92
2c2q_A_199 G/U mismatch-specific DNA glycosylase; radiation r 96.21
1mug_A_168 Protein (G:T/U specific DNA glycosylase); hydrolas 96.04
2d3y_A_219 Uracil-DNA glycosylase; base excision repair, iron 93.55
>2boo_A (A:) UDG, uracil-DNA glycosylase; UNG, base excision repair, radiation resistance, DNA damage, DNA repair, glycosidase, hydrolase; 1.8A {Deinococcus radiodurans} Back     alignment and structure
Probab=100.00  E-value=0  Score=598.12  Aligned_cols=225  Identities=48%  Similarity=0.920  Sum_probs=217.4

Q ss_pred             CCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCEECCCHHHHHHHHHCCCHHHCEEEEEECCCCCCCCCCCCCEE
Q ss_conf             98686873389998887265899999999999997798085887699999842998617799981188877520007100
Q gi|254781074|r    1 MEGVKIHESWKSLLENHFQSEHMRNLKEFLLSEKRKGKRIFPRGSHYFRAFDITPFNKVKVVILGQDPYHNYGQAHGLCF   80 (227)
Q Consensus         1 l~~l~i~~sW~~~L~~e~~~~~~~~i~~~l~~e~~~~~~i~P~~~~IF~af~~~p~~~vKVVIlGQDPY~~~g~A~GLaF   80 (227)
                      |.+..|+++|+++|++|+.++|+.+|.++|.+++.+ .+|||++++||+||++||+++|||||+||||||++|||+||||
T Consensus        18 ~~~~~i~~~W~~~l~~e~~~~y~~~l~~~l~~~~~~-~~i~P~~~~iF~af~~~p~~~vKVVIlGQDPY~~~g~A~GLaF   96 (247)
T 2boo_A           18 IIPANLPEDWQEALLPEFSAPYFHELTDFLRQERKE-YTIYPPAPDVFNALRYTPLGEVKVLILGQDPYHGPNQAHGLSF   96 (247)
T ss_dssp             CSCTTCCHHHHHHHHHHHTSHHHHHHHHHHHHHHHH-SCEESCGGGTTHHHHHSCGGGCCEEEEESSCCCSTTCCSSSSS
T ss_pred             CCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHC-CCCCCCHHHHHHHHHCCCHHHCEEEEEECCCCCCCCEECEEEE
T ss_conf             766788888999999886329999999999999838-9244988999999852698577599995568855552211200


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHC-CCCCCCCCHHHHHHCCCEEEECCHHCCCCCCCHHHHHCCHHHHHHHHHHHHHCCCC
Q ss_conf             03479863046999999999741-88887740124322089688601011236860445432599999999999961789
Q gi|254781074|r   81 SVPLGIRIPPSLVNVYKELQEDV-NFIPPTHGFLEHWGHEGVLLLNAVLTVEEGRAASHRGRGWEQFTDSVIDLISNNHQ  159 (227)
Q Consensus        81 sv~~~~~~p~SLrNI~Kel~~d~-~~~~~~~g~L~~Wa~QGVLLLNt~LTv~~g~~~SH~~~gW~~ft~~ii~~l~~~~~  159 (227)
                      ||+.++++|||||||||||++|| ++..+.+|||++||+||||||||+|||++|+|+||+++||++||+.+|++|+++++
T Consensus        97 sv~~~~~~p~SL~NI~kEL~~d~~~~~~~~~g~L~~Wa~QGVLLLNt~LTv~~g~~~SH~~~gWe~ft~~ii~~l~~~~~  176 (247)
T 2boo_A           97 SVRPGVRVPPSLRNIYKELTEDIPGFVAPKHGYLRSWAEQGVLLLNAVLTVRAGQANSHQGKGWEHFTDAVIKAVNAKEE  176 (247)
T ss_dssp             CCCTTSCCCHHHHHHHHHHHHHSTTCCCCSSCCCHHHHTTTEEEEESSCCEETTBTTTTTTSSHHHHHHHHHHHHHTCSS
T ss_pred             ECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             31179789932789999999860798788886266697687789860165218875665213099999999999982568


Q ss_pred             CEEEEEECCHHHHHHHCCCCCCCEEEEECCCCHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             87999975323334420576660799847888222578862787089999999987889746508898
Q gi|254781074|r  160 NIVFMLWGASAQKKQDVLDHKRHLVLKAAHPSPLSASHGFFGCRHFSKANRYLQEHGKTTVNWQIPLS  227 (227)
Q Consensus       160 ~vVfiLwG~~A~~~~~~i~~~~~~il~~~HPSPls~~~gF~~~~~F~~~N~~L~~~~~~~IdW~lp~~  227 (227)
                      ++||||||++||++++.|+..+|+||+++||||||+ |||+||+||++||++|+++|++||||+||.+
T Consensus       177 ~iVf~LWG~~A~~~~~~i~~~~~~il~s~HPSpls~-~~F~~~~~F~~~N~~L~~~g~~pIdW~lp~~  243 (247)
T 2boo_A          177 RVVFILWGSYARKKKKLITGKNHVVIESGHPSPLSE-QYFFGTRPFSKTNEALEKAGRGPVEWQLPAT  243 (247)
T ss_dssp             CCEEEEESHHHHGGGGGCCCTTCEEEEECCSSTTTG-GGTTTCCHHHHHHHHHHHTTCCCCCCCCCSS
T ss_pred             CEEEEEEHHHHHHHHHHCCCCCCEEEECCCCCHHHC-CCCCCCCHHHHHHHHHHHCCCCCEEECCCCC
T ss_conf             859997157899887404677865997089881113-8998998489999999987999862018873



>2zhx_A (A:) UDG, uracil-DNA glycosylase; DNA repair, UNG-UGI complex, UNG-DNA interactions, cytoplasm, DNA damage; 3.10A {Mycobacterium tuberculosis} Back     alignment and structure
>3fci_A (A:) UDG, uracil-DNA glycosylase; DNA repair, alternative splicing, disease mutation, DNA damage, glycosidase, HOST- virus interaction, hydrolase; HET: 3FI; 1.27A {Homo sapiens} PDB: 1emh_A* 1emj_A* 1q3f_A* 1ssp_E* 1ugh_E 1akz_A* 2oxm_A* 2oyt_A* 3fcf_A* 2hxm_A* 3fck_B* 3fcl_A* 2ssp_E* 1yuo_A 4skn_E* 1okb_A Back     alignment and structure
>4eug_A (A:45-229) UDG, UNG, protein (glycosylase); 1.40A {Escherichia coli} Back     alignment and structure
>2j8x_A (A:48-231) Uracil-DNA glycosylase; hydrolase/inhibitor, hydrolase/inhibitor complex, EBV, DNA repair, lytic protein, epstein-BARR virus; 2.3A {Epstein-barr virus} Back     alignment and structure
>3cxm_A (A:83-268) Uracil-DNA glycosylase; base excision repair, BER, DNA damage repair, MSGPP, SGPP, hydrolase, 5-bromouracil, structural genomics; 1.50A {Leishmania naiffi} Back     alignment and structure
>1udg_A (A:70-244) Uracil-DNA glycosylase; hydrolase; 1.75A {Herpes simplex virus} Back     alignment and structure
>2owr_A (A:48-218) UDG, uracil-DNA glycosylase; uracil-DNA glycosylase fold in the core: 3 layers (A/B/A); HET: EPE; 2.30A {Vaccinia virus} PDB: 2owq_A Back     alignment and structure
>1wyw_A (A:1-199) TDG, G/T mismatch-specific thymine DNA glycosylase; hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1ui0_A (A:) Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, riken structural genomics/proteomics initiative, RSGI; 1.50A {Thermus thermophilus} Back     alignment and structure
>2c2q_A (A:) G/U mismatch-specific DNA glycosylase; radiation resistance, DNA repair enzymes, uracil-DNA glycosylase, MUG, hydrolase; 1.7A {Deinococcus radiodurans} PDB: 2c2p_A Back     alignment and structure
>1mug_A (A:) Protein (G:T/U specific DNA glycosylase); hydrolase; 1.80A {Escherichia coli} Back     alignment and structure
>2d3y_A (A:) Uracil-DNA glycosylase; base excision repair, iron/sulfer cluster, thermophIle, structural genomics, NPPSFA; HET: DU; 1.55A {Thermus thermophilus HB8} PDB: 2ddg_A* 2dem_A* 2dp6_A* Back     alignment and structure