254781075

254781075

hypothetical protein CLIBASIA_04885

GeneID in NCBI database:8210099Locus tag:CLIBASIA_04885
Protein GI in NCBI database:254781075Protein Accession:YP_003065488.1
Gene range:+(1076819, 1077619)Protein Length:266aa
Gene description:hypothetical protein
COG prediction:[J] Alanyl-tRNA synthetase
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MWERIANTIVATSKKWSFLFAILSPTEVYNVHRRIWHLLRDDFGYFTKRTFFCFAFFITIIYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILVATDDRKLRMIEDGDRIIEIIQSIRRAFDQYKEEERKALSDIQEQLLNDASKKIVFSSDREEYIGLHQKQIDLIHQNIDRHLARMKNQLVAESDELEDILSRYSIESIPLDLPEMSQDEAIKYINHVYLLGKWISRGEIQRSQIARREYIGYLQ
cHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccEEEHHHHHHHHHHHHHHHHHHHHHHEEccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccEEEcccccHHHHHHHHHHHHHHHHHHEccccHHEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcc
MWERIANTIVATSKKWSFLFAILSPTEVYNVHRRIWHLLRddfgyftkrtFFCFAFFITIIYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILVATDDRKLRMIEDGDRIIEIIQSIRRAFDQYKEEERKALSDIQEQLLNDAskkivfssdreEYIGLHQKQIDLIHQNIDRHLARMKNQLVAESDELEDILSRYsiesipldlpemsqDEAIKYINHVYLLGKwisrgeiqRSQIARREYIGYLQ
mweriantivatskkwsFLFAILSPTEVYNVHRRIWHLLRDDFGYFTKRTFFCFAFFITIIYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILVATDDRKLRMIEDGDRIIEIIQSIRRAFDQYKEEERKALSDIQEQLLNDASKKIVFSSDREEYIGLHQKQIDLIHQNIDRHLARMKNQLVAESDELEDILSRYSIESIPLDLPEMSQDEAIKYINHVYLLGkwisrgeiqrsqiARREYIGYLQ
MWERIANTIVATSKKWSFLFAILSPTEVYNVHRRIWHLLRDDFGYftkrtffcfaffitiiYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILVATDDRKLRMIEDGDRIIEIIQSIRRAFDQYKEEERKALSDIQEQLLNDASKKIVFSSDREEYIGLHQKQIDLIHQNIDRHLARMKNQLVAESDELEDILSRYSIESIPLDLPEMSQDEAIKYINHVYLLGKWISRGEIQRSQIARREYIGYLQ
***RIANTIVATSKKWSFLFAILSPTEVYNVHRRIWHLLRDDFGYFTKRTFFCFAFFITIIYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILVATDDRKLRMIEDGDRIIEIIQSIRRAF*****************LLNDASKKIVFSSDREEYIGLHQKQIDLIHQNIDRHLARMKNQLVAESDELEDILSRYSIESIPLDLPEMSQDEAIKYINHVYLLGKWISRGEIQRSQIARREYIGYL*
MWERIANTIVATSKKWSFLFAILSPTEVYNVHRRIWHLLRDDFGYFTKRTFFCFAFFITIIYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILVATDDRKLRMIEDGDRIIEIIQSIRRAFDQYKEEERKALSDIQEQLLNDASKKIVFSSDREEYIGLHQKQIDLIHQNIDRHLARMKNQLVAESDELEDILSRYSIESIPLDLPEMSQDEAIKYINHVYLLGKWISRGEIQRSQIARREYIGYLQ
MWERIANTIVATSKKWSFLFAILSPTEVYNVHRRIWHLLRDDFGYFTKRTFFCFAFFITIIYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILVATDDRKLRMIEDGDRIIEIIQSIRRAFDQYKEEERKALSDIQEQLLNDASKKIVFSSDREEYIGLHQKQIDLIHQNIDRHLARMKNQLVAESDELEDILSRYSIESIPLDLPEMSQDEAIKYINHVYLLGKWISRGEIQRSQIARREYIGYLQ
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWERIANTIVATSKKWSFLFAILSPTEVYNVHRRIWHLLRDDFGYFTKRTFFCFAFFITIIYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILVATDDRKLRMIEDGDRIIEIIQSIRRAFDQYKEEERKALSDIQEQLLNDASKKIVFSSDREEYIGLHQKQIDLIHQNIDRHxxxxxxxxxxxxxxxxxxxxxxxxxSIPLDLPEMSQDEAIKYINHVYLLGKWISRGEIQRSQIARREYIGYLQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target266 hypothetical protein CLIBASIA_04885 [Candidatus Liberib
254781163214 hypothetical protein CLIBASIA_05350 [Candidatus Li 6e-05
>gi|254781163|ref|YP_003065576.1| hypothetical protein CLIBASIA_05350 [Candidatus Liberibacter asiaticus str. psy62] Length = 214 Back     alignment
 Score = 39.7 bits (91), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 55/270 (20%), Positives = 100/270 (37%), Gaps = 73/270 (27%)

Query: 3   ERIANTIVATSKKWSFL---FAILSPTEVYNVHRRIWHLLR---DDFGYFTKRTFF---C 53
           + I     +T K   F+   F +    E     R++W LLR    +F     RTF    C
Sbjct: 6   DSIPKITSSTGKCLKFIMRAFGLFDSAE----QRKLWSLLRYWSVEFWELLCRTFLWLLC 61

Query: 54  FAFFITIIYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILV 113
             FF    Y FF            +   Y +S +           I   + +L  S ++ 
Sbjct: 62  LGFFTLFAYWFFG-----------EKFSYDVSIK-----------IVLAINVLLFSFVIA 99

Query: 114 ATDDRKLRMIEDGDRIIEIIQSIRRAFDQYKEEERKALSDIQEQLLNDASKKIVFSSDRE 173
              +  + M +D  ++  +I +I   + QY E  + +  ++++   N       F +  +
Sbjct: 100 LLGNPNIEMAKDIAQLFTLIDNIENGYGQYLE--KISQKNVEKDFFNSK-----FFTHFK 152

Query: 174 EYIGLHQKQIDLIHQNIDRHLARMKNQLVAESDELEDILSRYSIESIPLDLPEMSQDEAI 233
           EYI                             DE++ IL RY IE IP  L +   ++  
Sbjct: 153 EYI-----------------------------DEVDKILMRYGIEGIP--LTDFDHEKIK 181

Query: 234 KYINHVYLLGKWISRGEIQRSQIARREYIG 263
            Y+ H+ ++   + +  I  ++  R ++IG
Sbjct: 182 SYLTHIKIVRDCLKKDNIHYAKELRNDWIG 211

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target266 hypothetical protein CLIBASIA_04885 [Candidatus Liberib
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated PIT, 2e-06
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
 Score = 48.0 bits (113), Expect = 2e-06
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 19/80 (23%)

Query: 123 IEDGDRIIEIIQSIRRAFDQYKEEERK------ALSDIQEQLLNDASKKIVFSSDREEYI 176
           I   DR+ +  +SIR+    ++EE+RK      A S + EQ   + +KK     D EE+ 
Sbjct: 74  IAQADRLTQEPESIRK----WREEQRKRLQELDAASKVMEQEWREKAKK-----DLEEW- 123

Query: 177 GLHQKQIDLIHQN-IDRHLA 195
             +Q+Q + + +N I+  +A
Sbjct: 124 --NQRQSEQVEKNKINNRIA 141


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00