254781083

254781083

hypothetical protein CLIBASIA_04925

GeneID in NCBI database:8210107Locus tag:CLIBASIA_04925
Protein GI in NCBI database:254781083Protein Accession:YP_003065496.1
Gene range:-(1082865, 1083347)Protein Length:160aa
Gene description:hypothetical protein
COG prediction:[E] Methionine synthase II (cobalamin-independent)
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MTYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPHSHLVKEDKVDEKNSSSELKVDLNKLNAPGSP
ccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccHHHEEccHHHHHHHHHccccccccEEEEEHHHccccccc
ccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHEHEEcccccccccEEEEEccccccEEcccccccccccccEEEHHHccccccc
mtylsvtwNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVvgphipnsnvfssSVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFakypkkvgpsvidvvyphshlvkedkvdeknssselkvdlnklnapgsp
MTYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVarvvgphipnsnvfsssvRRTYWSERGDIINaldqdlqdvESIEVFEYLKTRLSDLEAHRRSMSFYFakypkkvgpSVIDVVYPHShlvkedkvdeknssselkvdlnklnapgsp
MTYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPHSHLVKEDKVDEKNSSSELKVDLNKLNAPGSP
*TYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPHSHL*********************L******
MTYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPHSHLVKED***********KVDLNKLNAPGSP
*TYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPHSHLVKEDK******SSELKVDLNKLN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPHSHLVKEDKVDEKNSSSELKVDLNKLNAPGSP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 160 hypothetical protein CLIBASIA_04925 [Candidatus Liberib
TIGR01371778 met_syn_B12ind 5-methyltetrahydropteroyltriglutamate--h 90.07
>TIGR01371 met_syn_B12ind 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; InterPro: IPR006276 This group represents cobalamin-independent methionine synthase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00