254781084

254781084

hypothetical protein CLIBASIA_04930

GeneID in NCBI database:8210108Locus tag:CLIBASIA_04930
Protein GI in NCBI database:254781084Protein Accession:YP_003065497.1
Gene range:-(1083418, 1083597)Protein Length:59aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------6
MVSPPQFNSNSDMLVQADVDRAFSEMYGNSEQAAEKNSSSESKSKADLNKMNAPDSLPS
ccccccccccccEEEEEcHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHccccccccc
ccccccccccccEEEEccHHHHHHHHccccHHHHHcccccccccHHcHHHccccccccc
mvsppqfnsnsdmlVQADVDRAFSemygnseqaaeknssseskskadlnkmnapdslps
mvsppqfnsnsdmLVQADVDRAFSEMYGNseqaaeknssseskskadlnkmnapdslps
MVSPPQFNSNSDMLVQADVDRAFSEMYGnseqaaeknssseskskaDLNKMNAPDSLPS
*********NSDMLVQADVDRAFSE**********************************
*********NSDMLVQADVDRAFSEMYG*******************************
********S*SDMLVQADVDRAFSEMYGN******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSPPQFNSNSDMLVQADVDRAFSEMYGNSEQAAEKNSSSESKSKADLNKMNAPDSLPS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target59 hypothetical protein CLIBASIA_04930 [Candidatus Liberib
254781083160 hypothetical protein CLIBASIA_04925 [Candidatus Li 0.011
>gi|254781083|ref|YP_003065496.1| hypothetical protein CLIBASIA_04925 [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Back     alignment
 Score = 29.6 bits (65), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 2/26 (7%)

Query: 31  EQAAEKNSSSESKSKADLNKMNAPDS 56
           ++  EKNSSSE K   DLNK+NAP S
Sbjct: 136 DKVDEKNSSSELK--VDLNKLNAPGS 159

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00