254781088

254781088

F0F1 ATP synthase subunit A

GeneID in NCBI database:8210112Locus tag:CLIBASIA_04950
Protein GI in NCBI database:254781088Protein Accession:YP_003065501.1
Gene range:-(1085213, 1085965)Protein Length:250aa
Gene description:F0F1 ATP synthase subunit A
COG prediction:none
KEGG prediction:F0F1 ATP synthase subunit A (EC:3.6.3.14); K02108 F-type H+-transporting ATPase subunit a [EC:3.6.3.14]
SEED prediction:ATP synthase A chain (EC 3.6.3.14)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:F0F1-type ATP synthase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED6 TM-Helix
HMMTOP5 TM-Helix
MEMSAT7 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS7 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVYRSDQH
cccccHHHEEEcccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccccHHHHcccccccccccccEEEccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
mskspmsqfivqkivpiqvqgfdlsftNSSLAMLVSLLVIFIFAFFavsncrvvptRLQSFFEIIYQFIMSTLcdsagnqsknffPFVFSLFVFLTTAnllglhpylfsftsQIVVTTSFSLLVVLSVVISGFyvnglgflrlfipkdipllikPLVCFievssflfrpvsLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYigdvyrsdqh
MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVYRSDQH
MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNffpfvfslfvflTTANLLGLHPYLFSFTSQIvvttsfsllvvlsvvISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVYRSDQH
*SKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVYR****
********FIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVYRSDQH
*SKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVYRS***
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxx
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVYRSDQH
MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVYRSDQH
MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQSFFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYIGDVYRSDQH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target250 F0F1 ATP synthase subunit A [Candidatus Liberibacter as
315122432250 F0F1 ATP synthase subunit A [Candidatus Liberibacter so 1 5e-87
241203301250 F0F1 ATP synthase subunit A [Rhizobium leguminosarum bv 1 3e-69
227821026250 F0F1 ATP synthase subunit A [Sinorhizobium fredii NGR23 1 3e-68
163761007249 F0F1 ATP synthase subunit A [Hoeflea phototrophica DFL- 1 1e-67
15964588250 F0F1 ATP synthase subunit A [Sinorhizobium meliloti 102 1 1e-66
222147701250 F0F1 ATP synthase subunit A [Agrobacterium vitis S4] Le 1 1e-66
150395672250 F0F1 ATP synthase subunit A [Sinorhizobium medicae WSM4 1 2e-66
254718566249 F0F1 ATP synthase subunit A [Brucella sp. 83/13] Length 1 3e-66
306845016277 ATP synthase F0, A subunit [Brucella sp. BO1] Length = 1 4e-66
23501286249 F0F1 ATP synthase subunit A [Brucella suis 1330] Length 1 4e-66
>gi|315122432|ref|YP_004062921.1| F0F1 ATP synthase subunit A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 250 Back     alignment and organism information
 Score =  325 bits (832), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 174/250 (69%), Positives = 217/250 (86%)

Query: 1   MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQS 60
           MSKSPM QF+V KI+PI++ G D SFTNSSL+ML+S L+I  F+F AV   R+ PTRLQS
Sbjct: 1   MSKSPMGQFVVHKIIPIEIGGIDFSFTNSSLSMLISSLIILTFSFMAVRKYRICPTRLQS 60

Query: 61  FFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSF 120
             EI YQF+MSTLC+SAG +SK+FF FVFSLF+FLTTANLLG+ PYLFSFTSQIV+TT+F
Sbjct: 61  VLEITYQFVMSTLCNSAGPRSKSFFSFVFSLFLFLTTANLLGMFPYLFSFTSQIVITTTF 120

Query: 121 SLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANM 180
           +LLV+L V+ISGFYVNG GFL+LF+P  IP++++PLVCF+E++SF  RP+SLSLRLF+N+
Sbjct: 121 ALLVILVVIISGFYVNGWGFLKLFLPSGIPMVMRPLVCFVEIASFFSRPISLSLRLFSNI 180

Query: 181 LAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVY 240
           +AGH+MLKVFAGF  S++S+GMLG+ FS LPV  NVA+TGLEFFVAFMQAYIF++L C+Y
Sbjct: 181 MAGHIMLKVFAGFYFSILSLGMLGMVFSLLPVFVNVAITGLEFFVAFMQAYIFLMLTCLY 240

Query: 241 IGDVYRSDQH 250
           IGDVY+ DQH
Sbjct: 241 IGDVYQDDQH 250


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203301|ref|YP_002974397.1| F0F1 ATP synthase subunit A [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 250 Back     alignment and organism information
>gi|227821026|ref|YP_002824996.1| F0F1 ATP synthase subunit A [Sinorhizobium fredii NGR234] Length = 250 Back     alignment and organism information
>gi|163761007|ref|ZP_02168085.1| F0F1 ATP synthase subunit A [Hoeflea phototrophica DFL-43] Length = 249 Back     alignment and organism information
>gi|15964588|ref|NP_384941.1| F0F1 ATP synthase subunit A [Sinorhizobium meliloti 1021] Length = 250 Back     alignment and organism information
>gi|222147701|ref|YP_002548658.1| F0F1 ATP synthase subunit A [Agrobacterium vitis S4] Length = 250 Back     alignment and organism information
>gi|150395672|ref|YP_001326139.1| F0F1 ATP synthase subunit A [Sinorhizobium medicae WSM419] Length = 250 Back     alignment and organism information
>gi|254718566|ref|ZP_05180377.1| F0F1 ATP synthase subunit A [Brucella sp. 83/13] Length = 249 Back     alignment and organism information
>gi|306845016|ref|ZP_07477597.1| ATP synthase F0, A subunit [Brucella sp. BO1] Length = 277 Back     alignment and organism information
>gi|23501286|ref|NP_697413.1| F0F1 ATP synthase subunit A [Brucella suis 1330] Length = 249 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target250 F0F1 ATP synthase subunit A [Candidatus Liberibacter as
PRK05815227 PRK05815, PRK05815, F0F1 ATP synthase subunit A; Valida 9e-43
TIGR01131226 TIGR01131, ATP_synt_6_or_A, ATP synthase subunit 6 (euk 3e-38
MTH00172232 MTH00172, ATP6, ATP synthase F0 subunit 6; Provisional 2e-35
COG0356246 COG0356, AtpB, F0F1-type ATP synthase, subunit a [Energ 9e-33
pfam00119217 pfam00119, ATP-synt_A, ATP synthase A chain 4e-31
KOG4665252 KOG4665, KOG4665, KOG4665, ATP synthase F0 subunit 6 an 1e-26
MTH00174252 MTH00174, ATP6, ATP synthase F0 subunit 6; Provisional 4e-24
MTH00173231 MTH00173, ATP6, ATP synthase F0 subunit 6; Provisional 7e-21
MTH00176229 MTH00176, ATP6, ATP synthase F0 subunit 6; Provisional 1e-20
MTH00157223 MTH00157, ATP6, ATP synthase F0 subunit 6; Provisional 9e-20
MTH00035229 MTH00035, ATP6, ATP synthase F0 subunit 6; Validated 7e-18
MTH00101226 MTH00101, ATP6, ATP synthase F0 subunit 6; Validated 1e-17
PRK13419342 PRK13419, PRK13419, F0F1 ATP synthase subunit A; Provis 2e-17
MTH00179227 MTH00179, ATP6, ATP synthase F0 subunit 6; Provisional 4e-17
MTH00005231 MTH00005, ATP6, ATP synthase F0 subunit 6; Provisional 2e-16
PRK13417352 PRK13417, PRK13417, F0F1 ATP synthase subunit A; Provis 1e-15
PRK13420226 PRK13420, PRK13420, F0F1 ATP synthase subunit A; Provis 2e-14
PRK13421223 PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provis 1e-13
CHL00046228 CHL00046, atpI, ATP synthase CF0 A subunit 4e-13
MTH00175244 MTH00175, ATP6, ATP synthase F0 subunit 6; Provisional 2e-39
MTH00132227 MTH00132, ATP6, ATP synthase F0 subunit 6; Provisional 1e-14
MTH00120227 MTH00120, ATP6, ATP synthase F0 subunit 6; Provisional 3e-14
MTH00073227 MTH00073, ATP6, ATP synthase F0 subunit 6; Provisional 5e-13
MTH00087195 MTH00087, ATP6, ATP synthase F0 subunit 6; Provisional 8e-06
TIGR03306217 TIGR03306, altF1_A, alternate F1F0 ATPase, F0 subunit A 2e-12
MTH00050170 MTH00050, ATP6, ATP synthase F0 subunit 6; Validated 0.003
>gnl|CDD|180273 PRK05815, PRK05815, F0F1 ATP synthase subunit A; Validated Back     alignment and domain information
>gnl|CDD|162216 TIGR01131, ATP_synt_6_or_A, ATP synthase subunit 6 (eukaryotes),also subunit A (prokaryotes) Back     alignment and domain information
>gnl|CDD|177226 MTH00172, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|30705 COG0356, AtpB, F0F1-type ATP synthase, subunit a [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|109186 pfam00119, ATP-synt_A, ATP synthase A chain Back     alignment and domain information
>gnl|CDD|39864 KOG4665, KOG4665, KOG4665, ATP synthase F0 subunit 6 and related proteins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|133799 MTH00174, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177227 MTH00173, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177229 MTH00176, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177214 MTH00157, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177110 MTH00035, ATP6, ATP synthase F0 subunit 6; Validated Back     alignment and domain information
>gnl|CDD|177163 MTH00101, ATP6, ATP synthase F0 subunit 6; Validated Back     alignment and domain information
>gnl|CDD|172043 PRK13419, PRK13419, F0F1 ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|177230 MTH00179, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|164583 MTH00005, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|184043 PRK13417, PRK13417, F0F1 ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|184044 PRK13420, PRK13420, F0F1 ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|184045 PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|176987 CHL00046, atpI, ATP synthase CF0 A subunit Back     alignment and domain information
>gnl|CDD|177228 MTH00175, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177190 MTH00132, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177181 MTH00120, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177144 MTH00073, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177152 MTH00087, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|132349 TIGR03306, altF1_A, alternate F1F0 ATPase, F0 subunit A Back     alignment and domain information
>gnl|CDD|177125 MTH00050, ATP6, ATP synthase F0 subunit 6; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 250 F0F1 ATP synthase subunit A [Candidatus Liberibacter as
MTH00175244 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
MTH00174252 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
PRK13416268 consensus 100.0
PRK13419335 F0F1 ATP synthase subunit A; Provisional 100.0
MTH00172232 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
PRK13421231 F0F1 ATP synthase subunit A; Provisional 100.0
COG0356246 AtpB F0F1-type ATP synthase, subunit a [Energy producti 100.0
PRK13420230 F0F1 ATP synthase subunit A; Provisional 100.0
CHL00046239 atpI ATP synthase CF0 A subunit 100.0
PRK05815235 F0F1 ATP synthase subunit A; Validated 100.0
PRK13417352 F0F1 ATP synthase subunit A; Provisional 100.0
pfam00119217 ATP-synt_A ATP synthase A chain. 100.0
TIGR03306217 altF1_A alternate F1F0 ATPase, F0 subunit A. and in pri 100.0
MTH00101226 ATP6 ATP synthase F0 subunit 6; Validated 100.0
MTH00120227 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
MTH00073227 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
PRK13418284 consensus 100.0
MTH00132227 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
KOG4665252 consensus 100.0
TIGR01131234 ATP_synt_6_or_A ATP synthase F0, A subunit; InterPro: I 100.0
MTH00035229 ATP6 ATP synthase F0 subunit 6; Validated 100.0
MTH00179227 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
MTH00176224 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
MTH00173231 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
MTH00146231 consensus 100.0
MTH00005231 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
MTH00157225 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
MTH00087194 ATP6 ATP synthase F0 subunit 6; Provisional 100.0
MTH00089183 consensus 100.0
MTH00050171 ATP6 ATP synthase F0 subunit 6; Validated 100.0
>MTH00175 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>MTH00174 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>PRK13416 consensus Back     alignment and domain information
>PRK13419 F0F1 ATP synthase subunit A; Provisional Back     alignment and domain information
>MTH00172 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>PRK13421 F0F1 ATP synthase subunit A; Provisional Back     alignment and domain information
>COG0356 AtpB F0F1-type ATP synthase, subunit a [Energy production and conversion] Back     alignment and domain information
>PRK13420 F0F1 ATP synthase subunit A; Provisional Back     alignment and domain information
>CHL00046 atpI ATP synthase CF0 A subunit Back     alignment and domain information
>PRK05815 F0F1 ATP synthase subunit A; Validated Back     alignment and domain information
>PRK13417 F0F1 ATP synthase subunit A; Provisional Back     alignment and domain information
>pfam00119 ATP-synt_A ATP synthase A chain Back     alignment and domain information
>TIGR03306 altF1_A alternate F1F0 ATPase, F0 subunit A Back     alignment and domain information
>MTH00101 ATP6 ATP synthase F0 subunit 6; Validated Back     alignment and domain information
>MTH00120 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>MTH00073 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>PRK13418 consensus Back     alignment and domain information
>MTH00132 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>KOG4665 consensus Back     alignment and domain information
>TIGR01131 ATP_synt_6_or_A ATP synthase F0, A subunit; InterPro: IPR000568 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>MTH00035 ATP6 ATP synthase F0 subunit 6; Validated Back     alignment and domain information
>MTH00179 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>MTH00176 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>MTH00173 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>MTH00146 consensus Back     alignment and domain information
>MTH00005 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>MTH00157 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>MTH00087 ATP6 ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>MTH00089 consensus Back     alignment and domain information
>MTH00050 ATP6 ATP synthase F0 subunit 6; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target250 F0F1 ATP synthase subunit A [Candidatus Liberibacter as
1c17_M177 ATP synthase subunit A; membrane protein, helix, comple 1e-14
>1c17_M ATP synthase subunit A; membrane protein, helix, complex; NMR {Escherichia coli} SCOP: f.18.1.1 Length = 177 Back     alignment and structure
 Score = 75.4 bits (185), Expect = 1e-14
 Identities = 47/183 (25%), Positives = 74/183 (40%), Gaps = 30/183 (16%)

Query: 79  NQSKNFFPFVFSLFVFLTTANLLGLHPYLF----------------SFTSQIVVTTSFSL 122
            +SK   P   ++FV++   NL+ L P                     ++ + VT S +L
Sbjct: 2   GKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMAL 61

Query: 123 LVVLSVVISGFYVNGLG--FLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANM 180
            V + ++     + G+G     L +         P+   +E  S L +PVSL LRLF NM
Sbjct: 62  GVFILILFYSIKMKGIGGFTKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNM 121

Query: 181 LAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVY 240
            AG L+  + AG                +   + NV        +  +QA+IFMVL  VY
Sbjct: 122 YAGELIFILIAGL------------LPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVY 169

Query: 241 IGD 243
           +  
Sbjct: 170 LSM 172


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target250 F0F1 ATP synthase subunit A [Candidatus Liberibacter as
1c17_M177 ATP synthase subunit A; membrane protein, helix, comple 100.0
>1c17_M ATP synthase subunit A; membrane protein, helix, complex; NMR {Escherichia coli} SCOP: f.18.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=289.69  Aligned_cols=157  Identities=30%  Similarity=0.469  Sum_probs=137.8

Q ss_pred             CCCCCHHHHHHHHHHHHCCCCCCCHHH----------------HHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCC-CCCC
Q ss_conf             675302589999998512323230124----------------54431035542146799999999999841586-4211
Q gi|254781088|r   80 QSKNFFPFVFSLFVFLTTANLLGLHPY----------------LFSFTSQIVVTTSFSLLVVLSVVISGFYVNGL-GFLR  142 (250)
Q Consensus        80 ~~~~~~p~i~TlF~fIl~~NllGLiP~----------------~~~~Ta~l~~t~~lal~~~~~~~~~g~~~~g~-~~~~  142 (250)
                      |.|.+.|++.|+|+||+++|++|++|+                ..+||+|+|+|+++|+.+|+.+++.|+|++|. +|++
T Consensus         3 ~~~~~~P~~~tlF~fIl~~N~~gliP~~~~~~~~~~~~~~~~~~~~pTs~~~~t~~lAl~~~v~~~~~gi~~~G~~~~~~   82 (177)
T 1c17_M            3 KSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTK   82 (177)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCCCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCC-------
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHH
T ss_conf             74017999999999999999987326544420121002454445688767212799999999999999999925699989


Q ss_pred             CC-CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             13-89999875430233356776544133333577787776899999999999999987889999999999999999999
Q gi|254781088|r  143 LF-IPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGL  221 (250)
Q Consensus       143 ~~-~~~g~p~~l~p~~~~iE~is~~~rp~sLs~RLfgNi~aG~iil~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  221 (250)
                      ++ .|++.|+++.|++.++|++|+++||+|||+||||||+|||+++.+++++...            ..+...++.+.+|
T Consensus        83 ~~~~~~~~~~~l~p~~~~ie~is~~~rpiSLslRLFgNi~AG~ill~~~~~~~~~------------~~~~~~~i~~~~f  150 (177)
T 1c17_M           83 ELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPW------------WSQWILNVPWAIF  150 (177)
T ss_dssp             ----------------------CTTHHHHHHHHHHHHHHHHHHHHHHHHHHHSSS------------CHHHHHHHHHHHH
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------HHHHHHHHHHHHH
T ss_conf             9837887415888899999999981421889999999998768999999999999------------9999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             999999999999999999973340103
Q gi|254781088|r  222 EFFVAFMQAYIFMVLACVYIGDVYRSD  248 (250)
Q Consensus       222 el~v~~iQAyVF~~Lt~~Yi~~a~~~~  248 (250)
                      |++||++|||||++||++|+++|.|||
T Consensus       151 elfv~~IQAyVF~~Lt~vYi~~a~~eH  177 (177)
T 1c17_M          151 HILIITLQAFIFMVLTIVYLSMASEEH  177 (177)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCC------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             999999999999999999998676429




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 250 F0F1 ATP synthase subunit A [Candidatus Liberibacter as
d1c17m_171 f.18.1.1 (M:) F1F0 ATP synthase subunit A {Escherichia 3e-14
>d1c17m_ f.18.1.1 (M:) F1F0 ATP synthase subunit A {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: F1F0 ATP synthase subunit A
superfamily: F1F0 ATP synthase subunit A
family: F1F0 ATP synthase subunit A
domain: F1F0 ATP synthase subunit A
species: Escherichia coli [TaxId: 562]
 Score = 72.6 bits (178), Expect = 3e-14
 Identities = 47/181 (25%), Positives = 74/181 (40%), Gaps = 30/181 (16%)

Query: 79  NQSKNFFPFVFSLFVFLTTANLLGLHPYLF----------------SFTSQIVVTTSFSL 122
            +SK   P   ++FV++   NL+ L P                     ++ + VT S +L
Sbjct: 2   GKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMAL 61

Query: 123 LVVLSVVISGFYVNGLGF--LRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANM 180
            V + ++     + G+G     L +         P+   +E  S L +PVSL LRLF NM
Sbjct: 62  GVFILILFYSIKMKGIGGFTKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNM 121

Query: 181 LAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVY 240
            AG L+  + AG                +   + NV        +  +QA+IFMVL  VY
Sbjct: 122 YAGELIFILIAGL------------LPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVY 169

Query: 241 I 241
           +
Sbjct: 170 L 170


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target250 F0F1 ATP synthase subunit A [Candidatus Liberibacter as
d1c17m_171 F1F0 ATP synthase subunit A {Escherichia coli [TaxId: 5 100.0
>d1c17m_ f.18.1.1 (M:) F1F0 ATP synthase subunit A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: F1F0 ATP synthase subunit A
superfamily: F1F0 ATP synthase subunit A
family: F1F0 ATP synthase subunit A
domain: F1F0 ATP synthase subunit A
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=269.90  Aligned_cols=151  Identities=31%  Similarity=0.491  Sum_probs=133.2

Q ss_pred             CCCCCHHHHHHHHHHHHCCCCCCCHHHH----------------HHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCC-CCC
Q ss_conf             6753025899999985123232301245----------------44310355421467999999999998415864-211
Q gi|254781088|r   80 QSKNFFPFVFSLFVFLTTANLLGLHPYL----------------FSFTSQIVVTTSFSLLVVLSVVISGFYVNGLG-FLR  142 (250)
Q Consensus        80 ~~~~~~p~i~TlF~fIl~~NllGLiP~~----------------~~~Ta~l~~t~~lal~~~~~~~~~g~~~~g~~-~~~  142 (250)
                      |.|...|++.|+|+||+++|++|++|+.                .+||+|+++|+++|+.+|+.+++.|+|+||.+ +.+
T Consensus         3 ~~~~~~P~~~tlF~fIl~~Nl~gLiP~~~~~~~~~~~~~~~~~~~~~Ta~~~~t~~lal~~~~~~~~~gik~~G~~~~~~   82 (171)
T d1c17m_           3 KSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTK   82 (171)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCCCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCC-------
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHH
T ss_conf             72058999999999999999986544111278864022244212454211899899999999999999999926156778


Q ss_pred             CC-CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             13-89999875430233356776544133333577787776899999999999999987889999999999999999999
Q gi|254781088|r  143 LF-IPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGL  221 (250)
Q Consensus       143 ~~-~~~g~p~~l~p~~~~iE~is~~~rp~sLs~RLfgNi~aG~iil~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  221 (250)
                      ++ .|++.|+++.|++.++|++|+++||+|||+||||||+|||+++.+++++...            ..+...++++.++
T Consensus        83 ~~~~~~~~~~~l~p~~~~ie~is~~~rpvSLslRLFgNm~AG~ill~l~~~~~~~------------~~~~~~~v~~~~f  150 (171)
T d1c17m_          83 ELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPW------------WSQWILNVPWAIF  150 (171)
T ss_dssp             ----------------------CTTHHHHHHHHHHHHHHHHHHHHHHHHHHHSSS------------CHHHHHHHHHHHH
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------HHHHHHHHHHHHH
T ss_conf             8715345517999888999999999999999999999786039999999999999------------9999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999973
Q gi|254781088|r  222 EFFVAFMQAYIFMVLACVYIG  242 (250)
Q Consensus       222 el~v~~iQAyVF~~Lt~~Yi~  242 (250)
                      |++||++|||||++||++|++
T Consensus       151 elfv~~iQAyVFt~Lt~vYis  171 (171)
T d1c17m_         151 HILIITLQAFIFMVLTIVYLS  171 (171)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHC
T ss_conf             999999999999999999959



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 250 F0F1 ATP synthase subunit A [Candidatus Liberibact
1c17_M_177 (M:) ATP synthase subunit A; membrane protein, hel 3e-19
>1c17_M (M:) ATP synthase subunit A; membrane protein, helix, complex; NMR {Escherichia coli}Length = 177 Back     alignment and structure
 Score = 89.8 bits (223), Expect = 3e-19
 Identities = 46/182 (25%), Positives = 73/182 (40%), Gaps = 30/182 (16%)

Query: 80  QSKNFFPFVFSLFVFLTTANLLGL----------------HPYLFSFTSQIVVTTSFSLL 123
           +SK   P   ++FV++   NL+ L                       ++ + VT S +L 
Sbjct: 3   KSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALG 62

Query: 124 VVLSVVISGFYVNGLGFL--RLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANML 181
           V + ++     + G+G     L +         P+   +E  S L +PVSL LRLF NM 
Sbjct: 63  VFILILFYSIKMKGIGGFTKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMY 122

Query: 182 AGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVYI 241
           AG L+  + AG                +   + NV        +  +QA+IFMVL  VY+
Sbjct: 123 AGELIFILIAGL------------LPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYL 170

Query: 242 GD 243
             
Sbjct: 171 SM 172


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target250 F0F1 ATP synthase subunit A [Candidatus Liberibacter as
1c17_M_177 ATP synthase subunit A; membrane protein, helix, c 100.0
>1c17_M (M:) ATP synthase subunit A; membrane protein, helix, complex; NMR {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=301.07  Aligned_cols=159  Identities=29%  Similarity=0.430  Sum_probs=145.5

Q ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCCHH----------------HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             7667530258999999851232323012----------------454431035542146799999999999841586421
Q gi|254781088|r   78 GNQSKNFFPFVFSLFVFLTTANLLGLHP----------------YLFSFTSQIVVTTSFSLLVVLSVVISGFYVNGLGFL  141 (250)
Q Consensus        78 g~~~~~~~p~i~TlF~fIl~~NllGLiP----------------~~~~~Ta~l~~t~~lal~~~~~~~~~g~~~~g~~~~  141 (250)
                      .|++|||.|++.|+|.||+++|++|++|                |.++||||+++|+++|+++|+.+++.|+|++|.+++
T Consensus         1 ~k~~~~~~p~~~tlF~fI~~~N~~glip~~~~~~~~~~~~g~~p~~~~pTa~~~~tl~LAl~~~~~~~~~g~~~~g~~~~   80 (177)
T 1c17_M            1 HGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGF   80 (177)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCCCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCC-----
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH
T ss_conf             99720689999999999999998853103232687640222442124512347899999999999999999998060666


Q ss_pred             CC--CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11--3899998754302333567765441333335777877768999999999999999878899999999999999999
Q gi|254781088|r  142 RL--FIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANMLAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVT  219 (250)
Q Consensus       142 ~~--~~~~g~p~~l~p~~~~iE~is~~~rp~sLs~RLfgNi~aG~iil~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  219 (250)
                      .+  +.|+|.|+++.|++.++|++|+++||+|||+||||||+|||++++++++..+.            ..+...+..+.
T Consensus        81 ~~~~~~P~g~p~~l~~~l~~iE~is~~~rplsLslRLf~Ni~AGhiil~li~~~~~~------------~~~~~~~~~~~  148 (177)
T 1c17_M           81 TKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPW------------WSQWILNVPWA  148 (177)
T ss_dssp             ------------------------CTTHHHHHHHHHHHHHHHHHHHHHHHHHHHSSS------------CHHHHHHHHHH
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------HHHHHHHHHHH
T ss_conf             788704234403899899999999999889999999998244578999999999999------------99999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999999999999999999973340103
Q gi|254781088|r  220 GLEFFVAFMQAYIFMVLACVYIGDVYRSD  248 (250)
Q Consensus       220 ~lel~v~~iQAyVF~~Lt~~Yi~~a~~~~  248 (250)
                      ++|++|++||||||++|+++|++|+.|||
T Consensus       149 ~~e~~v~~IQAyVF~~Lt~~Yi~~~~~~h  177 (177)
T 1c17_M          149 IFHILIITLQAFIFMVLTIVYLSMASEEH  177 (177)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCC------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999998676439