254781087

254781087

H+transporting two-sector ATPase C subunit

GeneID in NCBI database:8210111Locus tag:CLIBASIA_04945
Protein GI in NCBI database:254781087Protein Accession:YP_003065500.1
Gene range:-(1084863, 1085138)Protein Length:91aa
Gene description:H+transporting two-sector ATPase C subunit
COG prediction:[C] F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K
KEGG prediction:H+transporting two-sector ATPase C subunit; K02110 F-type H+-transporting ATPase subunit c [EC:3.6.3.14]
SEED prediction:ATP synthase C chain (EC 3.6.3.14)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:F0F1-type ATP synthase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI
ccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYlsgafrnpcaasahkTEVLIFAVIAESLGLFLLLVVMLLLFVI
MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI
MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESlglflllvvmlllfvI
***************GYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI
MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI
***QMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI
MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI
MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target91 H+transporting two-sector ATPase C subunit [Candidatus
31512243386 H+transporting two-sector ATPase C subunit [Candidatus 1 2e-17
15842588575 ATP synthase C chain precursor [Azorhizobium caulinodan 1 4e-13
15425115274 F0F1 ATP synthase subunit C [Parvibaculum lavamentivora 1 2e-11
18267773576 H+transporting two-sector ATPase C subunit [Beijerincki 1 2e-10
29829436875 H+transporting two-sector ATPase C subunit [Starkeya no 1 8e-10
15424592175 H+transporting two-sector ATPase C subunit [Xanthobacte 1 1e-09
24085006076 ATP synthase subunit C [Bartonella grahamii as4aup] Len 1 2e-08
4947396076 F0F1 ATP synthase subunit C [Bartonella quintana str. T 1 2e-08
16386785276 F0F1 ATP synthase subunit C [Bartonella tribocorum CIP 1 2e-08
11479882578 ATP synthase F0 subunit C [Hyphomonas neptunium ATCC 15 1 3e-08
>gi|315122433|ref|YP_004062922.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 86 Back     alignment and organism information
 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/61 (68%), Positives = 51/61 (83%)

Query: 17 YYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76
          YYS AAKY+A+GMACLGMG VALA+ NIF++YLSGA RNP AA+  +  VL+FA +AESL
Sbjct: 12 YYSGAAKYIAIGMACLGMGFVALAIGNIFSSYLSGALRNPSAAADQQARVLVFAAVAESL 71

Query: 77 G 77
          G
Sbjct: 72 G 72


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|158425885|ref|YP_001527177.1| ATP synthase C chain precursor [Azorhizobium caulinodans ORS 571] Length = 75 Back     alignment and organism information
>gi|154251152|ref|YP_001411976.1| F0F1 ATP synthase subunit C [Parvibaculum lavamentivorans DS-1] Length = 74 Back     alignment and organism information
>gi|182677735|ref|YP_001831881.1| H+transporting two-sector ATPase C subunit [Beijerinckia indica subsp. indica ATCC 9039] Length = 76 Back     alignment and organism information
>gi|298294368|ref|YP_003696307.1| H+transporting two-sector ATPase C subunit [Starkeya novella DSM 506] Length = 75 Back     alignment and organism information
>gi|154245921|ref|YP_001416879.1| H+transporting two-sector ATPase C subunit [Xanthobacter autotrophicus Py2] Length = 75 Back     alignment and organism information
>gi|240850060|ref|YP_002971453.1| ATP synthase subunit C [Bartonella grahamii as4aup] Length = 76 Back     alignment and organism information
>gi|49473960|ref|YP_032002.1| F0F1 ATP synthase subunit C [Bartonella quintana str. Toulouse] Length = 76 Back     alignment and organism information
>gi|163867852|ref|YP_001609056.1| F0F1 ATP synthase subunit C [Bartonella tribocorum CIP 105476] Length = 76 Back     alignment and organism information
>gi|114798825|ref|YP_760621.1| ATP synthase F0 subunit C [Hyphomonas neptunium ATCC 15444] Length = 78 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target91 H+transporting two-sector ATPase C subunit [Candidatus
PRK0755874 PRK07558, PRK07558, F0F1 ATP synthase subunit C; Valida 6e-11
KOG3025137 KOG3025, KOG3025, KOG3025, Mitochondrial F1F0-ATP synth 0.003
>gnl|CDD|181027 PRK07558, PRK07558, F0F1 ATP synthase subunit C; Validated Back     alignment and domain information
>gnl|CDD|38235 KOG3025, KOG3025, KOG3025, Mitochondrial F1F0-ATP synthase, subunit c/ATP9/proteolipid [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 91 H+transporting two-sector ATPase C subunit [Candidatus
PRK07159101 F0F1 ATP synthase subunit C; Validated 100.0
PRK0755874 F0F1 ATP synthase subunit C; Validated 99.96
KOG3025137 consensus 99.96
PRK0891073 consensus 99.96
PRK1346979 F0F1 ATP synthase subunit C; Provisional 99.95
PRK1347185 F0F1 ATP synthase subunit C; Provisional 99.95
TIGR0332286 alt_F1F0_F0_C alternate F1F0 ATPase, F0 subunit C. A sm 99.92
PRK1346882 F0F1 ATP synthase subunit C; Provisional 99.92
PRK1347088 consensus 99.91
PRK0735481 F0F1 ATP synthase subunit C; Validated 99.91
CHL0006181 atpH ATP synthase CF0 C subunit 99.9
PRK08482105 F0F1 ATP synthase subunit C; Validated 99.86
PRK0787480 F0F1 ATP synthase subunit C; Validated 99.84
COG063679 AtpE F0F1-type ATP synthase, subunit c/Archaeal/vacuola 99.78
PRK0687678 F0F1 ATP synthase subunit C; Validated 99.77
PRK0588081 F0F1 ATP synthase subunit C; Validated 99.74
pfam0013766 ATP-synt_C ATP synthase subunit C. 99.66
PRK1346666 F0F1 ATP synthase subunit C; Provisional 99.38
PRK13464101 F0F1 ATP synthase subunit C; Provisional 99.36
PRK06251101 V-type ATP synthase subunit K; Validated 98.9
PRK1346766 F0F1 ATP synthase subunit C; Provisional 98.84
PRK08344159 V-type ATP synthase subunit K; Validated 98.73
PRK06558155 V-type ATP synthase subunit K; Validated 98.64
PRK06271213 V-type ATP synthase subunit K; Validated 98.4
PRK06271213 V-type ATP synthase subunit K; Validated 98.34
PRK08344159 V-type ATP synthase subunit K; Validated 98.14
PRK06558155 V-type ATP synthase subunit K; Validated 98.03
PRK09621141 V-type ATP synthase subunit K; Provisional 98.0
KOG0232156 consensus 97.0
PRK09621141 V-type ATP synthase subunit K; Provisional 96.83
PRK06649144 V-type ATP synthase subunit K; Validated 96.58
TIGR0126058 ATP_synt_c ATP synthase F0, C subunit; InterPro: IPR005 99.66
>PRK07159 F0F1 ATP synthase subunit C; Validated Back     alignment and domain information
>PRK07558 F0F1 ATP synthase subunit C; Validated Back     alignment and domain information
>KOG3025 consensus Back     alignment and domain information
>PRK08910 consensus Back     alignment and domain information
>PRK13469 F0F1 ATP synthase subunit C; Provisional Back     alignment and domain information
>PRK13471 F0F1 ATP synthase subunit C; Provisional Back     alignment and domain information
>TIGR03322 alt_F1F0_F0_C alternate F1F0 ATPase, F0 subunit C Back     alignment and domain information
>PRK13468 F0F1 ATP synthase subunit C; Provisional Back     alignment and domain information
>PRK13470 consensus Back     alignment and domain information
>PRK07354 F0F1 ATP synthase subunit C; Validated Back     alignment and domain information
>CHL00061 atpH ATP synthase CF0 C subunit Back     alignment and domain information
>PRK08482 F0F1 ATP synthase subunit C; Validated Back     alignment and domain information
>PRK07874 F0F1 ATP synthase subunit C; Validated Back     alignment and domain information
>COG0636 AtpE F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Energy production and conversion] Back     alignment and domain information
>PRK06876 F0F1 ATP synthase subunit C; Validated Back     alignment and domain information
>PRK05880 F0F1 ATP synthase subunit C; Validated Back     alignment and domain information
>pfam00137 ATP-synt_C ATP synthase subunit C Back     alignment and domain information
>PRK13466 F0F1 ATP synthase subunit C; Provisional Back     alignment and domain information
>PRK13464 F0F1 ATP synthase subunit C; Provisional Back     alignment and domain information
>PRK06251 V-type ATP synthase subunit K; Validated Back     alignment and domain information
>PRK13467 F0F1 ATP synthase subunit C; Provisional Back     alignment and domain information
>PRK08344 V-type ATP synthase subunit K; Validated Back     alignment and domain information
>PRK06558 V-type ATP synthase subunit K; Validated Back     alignment and domain information
>PRK06271 V-type ATP synthase subunit K; Validated Back     alignment and domain information
>PRK06271 V-type ATP synthase subunit K; Validated Back     alignment and domain information
>PRK08344 V-type ATP synthase subunit K; Validated Back     alignment and domain information
>PRK06558 V-type ATP synthase subunit K; Validated Back     alignment and domain information
>PRK09621 V-type ATP synthase subunit K; Provisional Back     alignment and domain information
>KOG0232 consensus Back     alignment and domain information
>PRK09621 V-type ATP synthase subunit K; Provisional Back     alignment and domain information
>PRK06649 V-type ATP synthase subunit K; Validated Back     alignment and domain information
>TIGR01260 ATP_synt_c ATP synthase F0, C subunit; InterPro: IPR005953 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target91 H+transporting two-sector ATPase C subunit [Candidatus
2xnd_J72 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 8e-14
2wpd_J76 The Mg.Adp Inhibited State Of The Yeast F1c10 Atp S 7e-13
1yce_A89 Structure Of The Rotor Ring Of F-Type Na+-Atpase Fr 7e-10
2wie_A82 High-Resolution Structure Of The Rotor Ring From A 5e-07
2w5j_A78 Structure Of The C14-Rotor Ring Of The Proton Trans 6e-06
2xqt_A82 Microscopic Rotary Mechanism Of Ion Translocation I 7e-06
>gi|306991573|pdb|2XND|J Chain J, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 72 Back     alignment and structure
 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 37/72 (51%)

Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77
             AAK++  G A +G+      +  +F + + G  RNP       +  ++   ++E++G
Sbjct: 1  IDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMG 60

Query: 78 LFLLLVVMLLLF 89
          LF L+V  L+LF
Sbjct: 61 LFCLMVAFLILF 72


gi|300193124|pdb|2WPD|J Chain J, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase Length = 76 Back     alignment and structure
gi|66360700|pdb|1YCE|A Chain A, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus Length = 89 Back     alignment and structure
>gi|260099798|pdb|2WIE|A Chain A, High-Resolution Structure Of The Rotor Ring From A Proton Dependent Atp Synthase Length = 82 Back     alignment and structure
>gi|237823447|pdb|2W5J|A Chain A, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase Length = 78 Back     alignment and structure
>gi|310689665|pdb|2XQT|A Chain A, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases Length = 82 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target91 H+transporting two-sector ATPase C subunit [Candidatus
2xnd_J72 ATP synthase lipid-binding protein, mitochondrial; ATP 3e-05
2xok_K76 ATP synthase subunit 9, mitochondrial; hydrolase, ATP-b 4e-05
2wgm_A89 ATP synthase subunit C, sodium ION specific; F1FO-ATP s 2e-04
>2xnd_J ATP synthase lipid-binding protein, mitochondrial; ATP phosphorylase (H+ transporting), ATP synthesis, F1FO ATP synthase, hydrolase, ION transport; HET: ANP; 3.50A {Bos taurus} Length = 72 Back     alignment and structure
 Score = 42.4 bits (100), Expect = 3e-05
 Identities = 20/69 (28%), Positives = 37/69 (53%)

Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80
          AAK++  G A +G+      +  +F + + G  RNP       +  ++   ++E++GLF 
Sbjct: 4  AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 63

Query: 81 LLVVMLLLF 89
          L+V  L+LF
Sbjct: 64 LMVAFLILF 72


>2xok_K ATP synthase subunit 9, mitochondrial; hydrolase, ATP-binding, F(O), F(1), mitochondr inner membrane, transmembrane; HET: ANP; 3.01A {Saccharomyces cerevisiae} PDB: 2wpd_J* Length = 76 Back     alignment and structure
>2wgm_A ATP synthase subunit C, sodium ION specific; F1FO-ATP synthase rotor, sodium-motive force, cell inner membrane, CF(0), membrane, transport; HET: F09; 2.35A {Ilyobacter tartaricus} PDB: 1yce_A* Length = 89 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target91 H+transporting two-sector ATPase C subunit [Candidatus
2xok_K76 ATP synthase subunit 9, mitochondrial; hydrolase, ATP-b 99.96
2wgm_A89 ATP synthase subunit C, sodium ION specific; F1FO-ATP s 99.94
2xnd_J72 ATP synthase lipid-binding protein, mitochondrial; ATP 99.93
2xqu_A82 C15_RING, ATP synthase C chain; membrane protein, F1FO- 99.92
1a91_A79 F1FO ATPase subunit C; membrane protein, hydrogen ION t 99.9
2x2v_A69 ATP synthase subunit C; membrane protein, ION transport 99.89
1wu0_A72 ATP synthase C chain; ATPase, membrane protein, hydroge 99.86
2bl2_A156 V-type sodium ATP synthase subunit K; V-type ATPase, K- 98.99
2bl2_A156 V-type sodium ATP synthase subunit K; V-type ATPase, K- 98.42
>2xok_K ATP synthase subunit 9, mitochondrial; hydrolase, ATP-binding, F(O), F(1), mitochondr inner membrane, transmembrane; HET: ANP; 3.01A {Saccharomyces cerevisiae} PDB: 2wpd_J* Back     alignment and structure
Probab=99.96  E-value=1.3e-30  Score=173.06  Aligned_cols=74  Identities=30%  Similarity=0.541  Sum_probs=71.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99999999999999998747899999999999998237878987999999999999999999999999999709
Q gi|254781087|r   18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI   91 (91)
Q Consensus        18 ~a~aak~IGAGlA~ig~~G~giGiG~if~~~i~~vaRNP~~~~~l~~~~ilG~Al~Ea~glfalviA~lllFav   91 (91)
                      ...++|+||+|+++++++|+|+|+|++|++++++++||||+++++|+|++||+|++|+++|||||++|+|+|+|
T Consensus         3 ~~~aak~iGaGlA~ig~~G~giG~G~vf~~~i~~iaRnP~a~~~l~~~~~lG~Al~Ea~~i~alvvA~lllFav   76 (76)
T 2xok_K            3 LVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV   76 (76)
T ss_dssp             CTTHHHHHHHHHGGGGHHHHHHHHHHHHHHHHHHHTSCSCTTTTHHHHTTHHHHHHHHHHHHHHHHHHHTTC--
T ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             89999999789999980117886999999999998638668986999999999999999999999999998609



>2wgm_A ATP synthase subunit C, sodium ION specific; F1FO-ATP synthase rotor, sodium-motive force, cell inner membrane, CF(0), membrane, transport; HET: F09; 2.35A {Ilyobacter tartaricus} PDB: 1yce_A* Back     alignment and structure
>2xnd_J ATP synthase lipid-binding protein, mitochondrial; ATP phosphorylase (H+ transporting), ATP synthesis, F1FO ATP synthase, hydrolase, ION transport; HET: ANP; 3.50A {Bos taurus} Back     alignment and structure
>2xqu_A C15_RING, ATP synthase C chain; membrane protein, F1FO-ATP synthase rotor, ION (PROT translocation; HET: FME CVM; 1.84A {Arthrospira platensis} PDB: 2xqs_A* 2wie_A* 2xqt_A* 2w5j_A Back     alignment and structure
>1a91_A F1FO ATPase subunit C; membrane protein, hydrogen ION transport; NMR {Escherichia coli} SCOP: f.17.1.1 PDB: 1c0v_A 1c17_A 1c99_A 1qo1_K 1aty_A 1l6t_A 1ijp_A Back     alignment and structure
>2x2v_A ATP synthase subunit C; membrane protein, ION transport, ATP synthesis, transmembran CF(0), membrane, transport, C-ring rotor; HET: FME DPV; 2.50A {Bacillus pseudofirmus OF4} Back     alignment and structure
>1wu0_A ATP synthase C chain; ATPase, membrane protein, hydrogen ION transport, hydrolase; NMR {Bacillus SP} Back     alignment and structure
>2bl2_A V-type sodium ATP synthase subunit K; V-type ATPase, K-ring, membrane rotor, sodium transporter, hydrogen ION transport, hydrolase; HET: LHG UMQ; 2.1A {Enterococcus hirae} PDB: 2cyd_A* 2db4_A* Back     alignment and structure
>2bl2_A V-type sodium ATP synthase subunit K; V-type ATPase, K-ring, membrane rotor, sodium transporter, hydrogen ION transport, hydrolase; HET: LHG UMQ; 2.1A {Enterococcus hirae} PDB: 2cyd_A* 2db4_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target91 H+transporting two-sector ATPase C subunit [Candidatus
d1c99a_79 F1F0 ATP synthase subunit C {Escherichia coli [TaxId: 5 99.9
>d1c99a_ f.17.1.1 (A:) F1F0 ATP synthase subunit C {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Transmembrane helix hairpin
superfamily: F1F0 ATP synthase subunit C
family: F1F0 ATP synthase subunit C
domain: F1F0 ATP synthase subunit C
species: Escherichia coli [TaxId: 562]
Probab=99.90  E-value=5.3e-24  Score=138.41  Aligned_cols=76  Identities=16%  Similarity=0.276  Sum_probs=72.1

Q ss_pred             HHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             3599999999999999-998747899999999999998237878987999999999999999999999999999709
Q gi|254781087|r   16 GYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI   91 (91)
Q Consensus        16 ~~~a~aak~IGAGlA~-ig~~G~giGiG~if~~~i~~vaRNP~~~~~l~~~~ilG~Al~Ea~glfalviA~lllFav   91 (91)
                      ++......++++|+++ ++.+|+|+|+|+++++++|+++||||+++++++++++|++++|+++||+++++++++|++
T Consensus         2 e~~~~~~~~l~agl~~gl~aiG~giG~G~~~~~ale~~ARqPE~~~~l~~~m~ig~al~Ea~~i~~lvialillFa~   78 (79)
T d1c99a_           2 ENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAV   78 (79)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTT
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             34888899999999999998787887999999999998559317776999999999999999999999999999980



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 91 H+transporting two-sector ATPase C subunit [Candid
2wgm_A_89 (A:) ATP synthase subunit C, sodium ION specific; 4e-04
>2wgm_A (A:) ATP synthase subunit C, sodium ION specific; F1FO-ATP synthase rotor, sodium-motive force, cell inner membrane, CF(0), membrane, transport; HET: F09; 2.35A {Ilyobacter tartaricus} PDB: 1yce_A*Length = 89 Back     alignment and structure
 Score = 38.1 bits (89), Expect = 4e-04
 Identities = 16/71 (22%), Positives = 31/71 (43%)

Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79
          LAA  V  G A +      +         +    R P A     + +++   +AES G++
Sbjct: 11 LAASAVGAGTAMIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIY 70

Query: 80 LLLVVMLLLFV 90
           L++ ++LL+ 
Sbjct: 71 SLVIALILLYA 81


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target91 H+transporting two-sector ATPase C subunit [Candidatus
2wgm_A_89 ATP synthase subunit C, sodium ION specific; F1FO- 99.94
1a91_A_79 F1FO ATPase subunit C; membrane protein, hydrogen 99.92
2wie_A_82 C15_RING, ATP synthase C chain; hydrolase, F1FO AT 99.91
1wu0_A_72 ATP synthase C chain; ATPase, membrane protein, hy 99.89
2bl2_A_156 V-type sodium ATP synthase subunit K; V-type ATPas 98.98
2bl2_A_156 V-type sodium ATP synthase subunit K; V-type ATPas 98.37
>2wgm_A (A:) ATP synthase subunit C, sodium ION specific; F1FO-ATP synthase rotor, sodium-motive force, cell inner membrane, CF(0), membrane, transport; HET: F09; 2.35A {Ilyobacter tartaricus} PDB: 1yce_A* Back     alignment and structure
Probab=99.94  E-value=1e-26  Score=154.07  Aligned_cols=77  Identities=21%  Similarity=0.236  Sum_probs=74.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             02359999999999999999874789999999999999823787898799999999999999999999999999970
Q gi|254781087|r   14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV   90 (91)
Q Consensus        14 ~~~~~a~aak~IGAGlA~ig~~G~giGiG~if~~~i~~vaRNP~~~~~l~~~~ilG~Al~Ea~glfalviA~lllFa   90 (91)
                      ++..+..+.++||+|++++|.+|+|+|+|+++++++|+++||||+++++++++++|+|++|+++|||||++++++|+
T Consensus         5 ~~~~~~~~~~~igagla~lga~G~giG~G~~~~~a~e~~aRqPe~~~~i~~~m~ig~Al~Ea~~i~~lvialillFa   81 (89)
T 2wgm_A            5 FAKTVVLAASAVGAGTAMIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLYA   81 (89)
T ss_dssp             HHHHHHHHHHHHHHHHHGGGGHHHHHHHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999999999999711698799999999999875907888199999999999999999999999999988



>1a91_A (A:) F1FO ATPase subunit C; membrane protein, hydrogen ION transport; NMR {Escherichia coli} Back     alignment and structure
>2wie_A (A:) C15_RING, ATP synthase C chain; hydrolase, F1FO ATP synthase rotor, ION proton-translocation, ION transport, transmembrane; HET: FME CVM; 2.13A {Arthrospira platensis} PDB: 2w5j_A Back     alignment and structure
>1wu0_A (A:) ATP synthase C chain; ATPase, membrane protein, hydrogen ION transport, hydrolase; NMR {Bacillus SP} Back     alignment and structure
>2bl2_A (A:) V-type sodium ATP synthase subunit K; V-type ATPase, K-ring, membrane rotor, sodium transporter, hydrogen ION transport, hydrolase; HET: LHG UMQ; 2.1A {Enterococcus hirae} PDB: 2cyd_A* 2db4_A* Back     alignment and structure
>2bl2_A (A:) V-type sodium ATP synthase subunit K; V-type ATPase, K-ring, membrane rotor, sodium transporter, hydrogen ION transport, hydrolase; HET: LHG UMQ; 2.1A {Enterococcus hirae} PDB: 2cyd_A* 2db4_A* Back     alignment and structure