254781094

254781094

glycyl-tRNA synthetase subunit beta

GeneID in NCBI database:8210118Locus tag:CLIBASIA_04980
Protein GI in NCBI database:254781094Protein Accession:YP_003065507.1
Gene range:-(1090299, 1092407)Protein Length:702aa
Gene description:glycyl-tRNA synthetase subunit beta
COG prediction:[J] Glycyl-tRNA synthetase, beta subunit
KEGG prediction:glyS; glycyl-tRNA synthetase subunit beta (EC:6.1.1.14); K01879 glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
SEED prediction:Glycyl-tRNA synthetase beta chain (EC 6.1.1.14)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Gly
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700--
MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV
cccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccEEEEEEcccccccccHHHHHcccccccccHHHHHHHHHccccHHHHHHHcccccccEEEEEEEEcccccHHHHHHHHHHHHHHccccccEEcccccccccccEEEEccHHHHHHHHccccccccEEEEEEcccccccEEEEEEcccccEEEEccHHHHHHHHHHccEEEcHHHHHHHHHHHHHHHHHHcccEEcccHHHHHHHHHHccccEEEEEEEcHHHHcccHHHHHHHHHHcccEEEEEccccccccccEEEEcccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHcccccEEEEHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHcc
cccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccEEEEEEcccHHHccccEEEccccccccHHHHHHHHHHcccccHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHHHHHHccccccccccccccccccccEEEEEcEEEEEEEccccccccEEEEEEEEEcccccEccccccccccEEEccHHHHHHHHHHccEEccHHHHHHHHHHHHHHHHHHcccEEEccHHHHHHHHHHcccccEEEEccHHHHHcccHHHHHHHccccccEEEEEcccccccccEEEEEcccccccHHHHHccccEEEEccHHHHHHHHHHcHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHcHccHHHHHcccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHcHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHcEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYlkglsphspekieerlgprvgagkKAIDGFlrstglqtisdcqikkdpkkgdVYLAVLRKPKRLIEDVLKTIVPVaiqkvpwpksmrwstthspisafswirPLKSILCILVAEDAKEKIIDldlkeipcgnityghrfhaphpikvqsLDHYIRDLEEAMVlldpecrrnailNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSfdkkylclpEELIRLTIKTNQKCFVTRTREGVLANCFILVSniqasdggaaivQGNSRVVAARLEDALHFWKrdqnnlpnlsslKESALKFNLDLSKPLDQRMARLDMLDVVFHakigtqgeRVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAieehlkprgplenvptnkiSITVSLADKLDTLINFwainekpsgskdpyaLRRATLGIIRIILEnkidiplsqfiedqnlILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHiqesmdhkryhQIGDLLHSICEPIEIFFDQVlvnvddrevRDNRLSLLQYIKNIILIVINVQKIV
MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIeerlgprvgAGKKAIDGFlrstglqtisdcqikkdpkkgdVYLAVLRkpkrliedvlktivpvaiqkvpwpksmrwSTTHSpisafswirPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHakigtqgervsrIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLkprgplenvptnKISITVSLADKLDTLINFWainekpsgskdpyaLRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEailrpendNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAieekknreisleiSPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV
MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGlelvedkdlleeIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV
MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSP**************GAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV
MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV
*PDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV
MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV
MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLSPHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLIEDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDLKEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVGLELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLANCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLDLSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKADLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLADKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHDRLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target702 glycyl-tRNA synthetase subunit beta [Candidatus Liberib
254781085173 F0F1 ATP synthase subunit B [Candidatus Liberibact 0.025
254780438261 pyridoxine 5'-phosphate synthase [Candidatus Liber 0.025
>gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 173 Back     alignment
 Score = 32.3 bits (72), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 52/102 (50%), Gaps = 16/102 (15%)

Query: 547 HDRDIRHDLIEAI-LRPENDNLLTIVDLIKHLNEFFSSAKGE--KFLLSAKRIFQILAIE 603
           H   IR D+ EA  LR +++N+L          E  S  + E  + +L+AK   +ILA E
Sbjct: 36  HADKIRDDIFEARRLREKSENILM------QYKEKHSKVEEETREIILAAKHRAKILAEE 89

Query: 604 EKKN-REIS------LEISPQYLLLEAEKRLYAVISDFGTHI 638
             +N  +IS      LE    Y+ LEA++ LYA I+DF   I
Sbjct: 90  GCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI 131

>gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Back     alignment
 Score = 32.3 bits (72), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 438 GKEYAVLQNENISCCDAIEEHLKPRGPLENVPT------NKISITVSLADKLDTLIN 488
           G E++ LQ   ++  D IE +  P G   N P       NK++IT  LA K+D  IN
Sbjct: 142 GNEHS-LQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQIN 197

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target702 glycyl-tRNA synthetase subunit beta [Candidatus Liberib
315122428700 glycyl-tRNA synthetase subunit beta [Candidatus Liberib 1 0.0
241203330704 glycyl-tRNA synthetase subunit beta [Rhizobium legumino 1 0.0
116250725704 glycyl-tRNA synthetase subunit beta [Rhizobium legumino 1 0.0
327190722704 glycyl-tRNA synthetase protein, beta subunit [Rhizobium 1 0.0
86356536704 glycyl-tRNA synthetase subunit beta [Rhizobium etli CFN 1 0.0
190890601704 glycyl-tRNA synthetase, beta subunit [Rhizobium etli CI 1 0.0
325292025717 glycyl-tRNA synthetase beta chain [Agrobacterium sp. H1 1 0.0
15887985717 glycyl-tRNA synthetase subunit beta [Agrobacterium tume 1 0.0
222085067742 glycyl-tRNA synthetase [Agrobacterium radiobacter K84] 1 0.0
209548144727 glycyl-tRNA synthetase subunit beta [Rhizobium legumino 1 0.0
>gi|315122428|ref|YP_004062917.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 700 Back     alignment and organism information
 Score = 1095 bits (2833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/702 (77%), Positives = 610/702 (86%), Gaps = 3/702 (0%)

Query: 1   MPDFLLEIYSEEIPARMQHKAAEDLSIILIGLLKEEGVIYQNMRQYWTPHRLFLYLKGLS 60
           M  FLLEIYSEEIPARMQ KA EDL   +  LLKE G+ Y+++RQYWTP RLF+YLKGL+
Sbjct: 2   MLGFLLEIYSEEIPARMQRKATEDLGKNVTRLLKEYGLSYESIRQYWTPRRLFVYLKGLT 61

Query: 61  PHSPEKIEERLGPRVGAGKKAIDGFLRSTGLQTISDCQIKKDPKKGDVYLAVLRKPKRLI 120
           P SPEKIEERLGPRVGA +KAI+GFL STGL+ ISDC+IKKDPKKGD+YLAV++KPKRL 
Sbjct: 62  PSSPEKIEERLGPRVGASQKAIEGFLHSTGLKKISDCKIKKDPKKGDLYLAVIKKPKRLA 121

Query: 121 EDVLKTIVPVAIQKVPWPKSMRWSTTHSPISAFSWIRPLKSILCILVAEDAKEKIIDLDL 180
           ED++K IVP+AIQ VPWPKSMRWST +SP+S FSWIRPL+SILC+L +++ K  IIDL+L
Sbjct: 122 EDIIKEIVPIAIQNVPWPKSMRWSTNNSPVSDFSWIRPLQSILCVLFSKEGKSTIIDLNL 181

Query: 181 KEIPCGNITYGHRFHAPHPIKVQSLDHYIRDLEEAMVLLDPECRRNAILNDAHRLASAVG 240
           K IPCGNITYGHRFHAP PIKV+ LD YI  LE+A VLLDPE RRN IL DA  L+S  G
Sbjct: 182 KGIPCGNITYGHRFHAPQPIKVKCLDSYISGLEKAKVLLDPEHRRNTILRDARLLSSVNG 241

Query: 241 LELVEDKDLLEEIIGLVEWVQVFMGSFDKKYLCLPEELIRLTIKTNQKCFVTRTREGVLA 300
           +ELVED  LLEEI+GLVEWVQV +GSFD+KYLCLPEELIRLTIKTNQKCFVTRTR+G LA
Sbjct: 242 VELVEDDGLLEEIVGLVEWVQVLIGSFDEKYLCLPEELIRLTIKTNQKCFVTRTRQGKLA 301

Query: 301 NCFILVSNIQASDGGAAIVQGNSRVVAARLEDALHFWKRDQNNLPNLSSLKESALKFNLD 360
           N FILVSNIQASDGG AIVQGNS+VVAARLEDALHFWKRDQ NLP++ SLKESALKFNLD
Sbjct: 302 NRFILVSNIQASDGGIAIVQGNSKVVAARLEDALHFWKRDQENLPDIDSLKESALKFNLD 361

Query: 361 LSKPLDQRMARLDMLDVVFHAKIGTQGERVSRIRVLGKKIAQLIDADVALVDRAIVLSKA 420
           LSKPLDQRMA+LD L+VVFHAKIGTQGERVSRIR+LGKKIAQLI  D+ALVDRA VL KA
Sbjct: 362 LSKPLDQRMAKLDALNVVFHAKIGTQGERVSRIRLLGKKIAQLIGVDIALVDRAAVLLKA 421

Query: 421 DLCTEIVREFPELQGKIGKEYAVLQNENISCCDAIEEHLKPRGPLENVPTNKISITVSLA 480
           DLCT+IVREFPELQGKIGKEYA LQNE I    AIEEHLKPRGPLE VPT+KISIT+SLA
Sbjct: 422 DLCTDIVREFPELQGKIGKEYANLQNETIVL--AIEEHLKPRGPLETVPTDKISITLSLA 479

Query: 481 DKLDTLINFWAINEKPSGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILFFHD 540
           DKLDTLINFWAINEKPSGS+DPYALRRA LGIIRIILENKI IPLSQF+EDQNLILFFH 
Sbjct: 480 DKLDTLINFWAINEKPSGSQDPYALRRAALGIIRIILENKIHIPLSQFVEDQNLILFFHV 539

Query: 541 RLKLYLHDRDIRHDLIEAILRPENDNLLTIVDLIKHLNEFFSSAKGEKFLLSAKRIFQIL 600
           RLKLYL +  IRHDLIEAIL+PENDNLL IVDLIK+LNEFF+S KG+ FL SAKRI QIL
Sbjct: 540 RLKLYLREIGIRHDLIEAILQPENDNLLVIVDLIKYLNEFFNSEKGKNFLFSAKRILQIL 599

Query: 601 AIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEP 660
           AIEEKK REI L I+PQ   LEAEK+LY VISD   HI++SM +  YH+IGDLL S+ EP
Sbjct: 600 AIEEKKGREI-LPIAPQKFSLEAEKKLYTVISDLDLHIKDSMHNNAYHRIGDLLFSLHEP 658

Query: 661 IEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKIV 702
           IE FFD V+VNV+D+EVR+NRL+LLQ  K II+ V ++QKIV
Sbjct: 659 IESFFDNVMVNVEDQEVRNNRLALLQCTKKIIMKVFDIQKIV 700


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203330|ref|YP_002974426.1| glycyl-tRNA synthetase subunit beta [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 704 Back     alignment and organism information
>gi|116250725|ref|YP_766563.1| glycyl-tRNA synthetase subunit beta [Rhizobium leguminosarum bv. viciae 3841] Length = 704 Back     alignment and organism information
>gi|327190722|gb|EGE57803.1| glycyl-tRNA synthetase protein, beta subunit [Rhizobium etli CNPAF512] Length = 704 Back     alignment and organism information
>gi|86356536|ref|YP_468428.1| glycyl-tRNA synthetase subunit beta [Rhizobium etli CFN 42] Length = 704 Back     alignment and organism information
>gi|190890601|ref|YP_001977143.1| glycyl-tRNA synthetase, beta subunit [Rhizobium etli CIAT 652] Length = 704 Back     alignment and organism information
>gi|325292025|ref|YP_004277889.1| glycyl-tRNA synthetase beta chain [Agrobacterium sp. H13-3] Length = 717 Back     alignment and organism information
>gi|15887985|ref|NP_353666.1| glycyl-tRNA synthetase subunit beta [Agrobacterium tumefaciens str. C58] Length = 717 Back     alignment and organism information
>gi|222085067|ref|YP_002543597.1| glycyl-tRNA synthetase [Agrobacterium radiobacter K84] Length = 742 Back     alignment and organism information
>gi|209548144|ref|YP_002280061.1| glycyl-tRNA synthetase subunit beta [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 727 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target702 glycyl-tRNA synthetase subunit beta [Candidatus Liberib
PRK01233682 PRK01233, glyS, glycyl-tRNA synthetase subunit beta; Va 0.0
TIGR00211691 TIGR00211, glyS, glycyl-tRNA synthetase, tetrameric typ 1e-117
PRK149081000 PRK14908, PRK14908, glycyl-tRNA synthetase; Provisional 1e-105
COG0751691 COG0751, GlyS, Glycyl-tRNA synthetase, beta subunit [Tr 0.0
pfam02092549 pfam02092, tRNA_synt_2f, Glycyl-tRNA synthetase beta su 1e-169
pfam05746117 pfam05746, DALR_1, DALR anticodon binding domain 3e-08
>gnl|CDD|179258 PRK01233, glyS, glycyl-tRNA synthetase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|161766 TIGR00211, glyS, glycyl-tRNA synthetase, tetrameric type, beta subunit Back     alignment and domain information
>gnl|CDD|184901 PRK14908, PRK14908, glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|31094 COG0751, GlyS, Glycyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|145318 pfam02092, tRNA_synt_2f, Glycyl-tRNA synthetase beta subunit Back     alignment and domain information
>gnl|CDD|147737 pfam05746, DALR_1, DALR anticodon binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 702 glycyl-tRNA synthetase subunit beta [Candidatus Liberib
PRK01233687 glyS glycyl-tRNA synthetase subunit beta; Validated 100.0
COG0751691 GlyS Glycyl-tRNA synthetase, beta subunit [Translation, 100.0
TIGR00211743 glyS glycyl-tRNA synthetase, beta subunit; InterPro: IP 100.0
pfam02092549 tRNA_synt_2f Glycyl-tRNA synthetase beta subunit. 100.0
pfam05746117 DALR_1 DALR anticodon binding domain. This all alpha he 98.65
smart00836122 DALR_1 DALR anticodon binding domain. This all alpha he 98.45
cd07956156 Anticodon_Ia_Arg Anticodon-binding domain of arginyl tR 98.2
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 98.07
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 98.02
PRK12451562 arginyl-tRNA synthetase; Reviewed 97.67
KOG1195567 consensus 94.01
KOG4426656 consensus 93.27
PRK12704455 phosphodiesterase; Provisional 98.09
PRK00106535 hypothetical protein; Provisional 97.99
PRK12705485 hypothetical protein; Provisional 97.98
PRK10119231 hypothetical protein; Provisional 96.94
smart00471124 HDc Metal dependent phosphohydrolases with conserved 'H 93.18
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 97.92
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF. 97.9
COG1418222 Predicted HD superfamily hydrolase [General function pr 96.85
LOAD_HD114 consensus 96.85
pfam01966108 HD HD domain. HD domains are metal dependent phosphohyd 95.98
PRK07152343 nadD putative nicotinate-nucleotide adenylyltransferase 95.97
COG1713187 Predicted HD superfamily hydrolase involved in NAD meta 95.66
PRK13300446 tRNA CCA-pyrophosphorylase; Provisional 94.25
TIGR03671408 cca_archaeal CCA-adding enzyme. 93.72
>PRK01233 glyS glycyl-tRNA synthetase subunit beta; Validated Back     alignment and domain information
>COG0751 GlyS Glycyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00211 glyS glycyl-tRNA synthetase, beta subunit; InterPro: IPR015944 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam02092 tRNA_synt_2f Glycyl-tRNA synthetase beta subunit Back     alignment and domain information
>pfam05746 DALR_1 DALR anticodon binding domain Back     alignment and domain information
>smart00836 DALR_1 DALR anticodon binding domain Back     alignment and domain information
>cd07956 Anticodon_Ia_Arg Anticodon-binding domain of arginyl tRNA synthetases Back     alignment and domain information
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG1195 consensus Back     alignment and domain information
>KOG4426 consensus Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PRK10119 hypothetical protein; Provisional Back     alignment and domain information
>smart00471 HDc Metal dependent phosphohydrolases with conserved 'HD' motif Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>COG1418 Predicted HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>LOAD_HD consensus Back     alignment and domain information
>pfam01966 HD HD domain Back     alignment and domain information
>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>COG1713 Predicted HD superfamily hydrolase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>PRK13300 tRNA CCA-pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR03671 cca_archaeal CCA-adding enzyme Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target702 glycyl-tRNA synthetase subunit beta [Candidatus Liberib
1f7u_A607 Arginyl-tRNA synthetase; RNA-protein complex, aminoacyl 1e-04
2zue_A629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP 0.001
>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation, ligase, ligase/RNA complex; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Length = 607 Back     alignment and structure
 Score = 43.5 bits (102), Expect = 1e-04
 Identities = 13/98 (13%), Positives = 34/98 (34%)

Query: 595 RIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLL 654
           R+  +        +E  +      L   A K L  ++  +   ++ ++       +   L
Sbjct: 495 RLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYL 554

Query: 655 HSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNII 692
             +   +   +D + V     E+   RL+L    + ++
Sbjct: 555 FKLTHQVSSCYDVLWVAGQTEELATARLALYGAARQVL 592


>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Length = 629 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target702 glycyl-tRNA synthetase subunit beta [Candidatus Liberib
1f7u_A607 Arginyl-tRNA synthetase; RNA-protein complex, aminoacyl 98.24
2zue_A629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP 97.87
1iq0_A592 Arginyl-tRNA synthetase; riken structural genomics/prot 97.42
3fnr_A464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, s 97.12
3ccg_A190 HD superfamily hydrolase; NP_347894.1, HD domain, struc 97.6
3b57_A209 LIN1889 protein; Q92AN1, X-RAY, NESG, structural genomi 97.41
2ogi_A196 Hypothetical protein SAG1661; NP_688652.1, conserved hy 97.16
2pq7_A220 Predicted HD superfamily hydrolase; 104161995, HD domai 97.13
2pjq_A231 Uncharacterized protein LP_2664; LPR71, NESG, structura 96.94
3dto_A223 BH2835 protein; all alpha-helical protein, structural g 96.87
2o08_A188 BH1327 protein; putative HD superfamily hydrolase, stru 96.66
3djb_A223 Hydrolase, HD family; all alpha-helical protein., struc 96.36
2qgs_A225 Protein Se1688; alpha-helical protein, structural genom 95.71
3gw7_A239 Uncharacterized protein YEDJ; all alpha-helical protein 96.27
3hc1_A305 Uncharacterized HDOD domain protein; HDOD domain protei 95.55
1vqr_A297 Hypothetical protein CJ0248; 6967725, structural genomi 93.5
>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation, ligase, ligase/RNA complex; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Back     alignment and structure
Probab=98.24  E-value=1e-05  Score=56.77  Aligned_cols=115  Identities=12%  Similarity=0.175  Sum_probs=95.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             19513889999999999855653124677777385683598999999999999999999850253899999998532788
Q gi|254781094|r  582 SSAKGEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPI  661 (702)
Q Consensus       582 ~~~~~~~l~~a~KRv~NIL~~~~k~~~~~~~~vd~~Lf~~~~Ek~L~~~~~~~~~~i~~~l~~~dy~~~L~~L~~L~~~I  661 (702)
                      +.+.+.=+.=++-|+.+|+.++...........|.+++.+++|++|...+......+..+.....=......|..|....
T Consensus       482 ~g~t~pYvQYahARi~SIlrka~~~~~~~~~~~d~~~L~~~~e~~L~~~L~~fp~vv~~a~~~~ePh~l~~YL~~LA~~f  561 (607)
T 1f7u_A          482 EGDTGPYLQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLTHQV  561 (607)
T ss_dssp             SSSSHHHHHHHHHHHHHHHHHTTTSCHHHHTTSCGGGCCSHHHHHHHHHHTTHHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             48854769999999999998720466200145553215999999999999989999999999598489999999999999


Q ss_pred             HHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             87510270368868999999999999999998606
Q gi|254781094|r  662 EIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVI  696 (702)
Q Consensus       662 d~FFDnVmVm~eD~~IR~NRL~LL~~i~~~f~~ia  696 (702)
                      +.|.++..|..+|+++++-||.|...++..+..-.
T Consensus       562 ~sfY~~~~Vl~~~~e~~~aRL~L~~a~~~vl~~gL  596 (607)
T 1f7u_A          562 SSCYDVLWVAGQTEELATARLALYGAARQVLYNGM  596 (607)
T ss_dssp             HHHHHHCCSTTSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99870187789998999999999999999999986



>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Back     alignment and structure
>3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.20A {Campylobacter jejuni} Back     alignment and structure
>3ccg_A HD superfamily hydrolase; NP_347894.1, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3b57_A LIN1889 protein; Q92AN1, X-RAY, NESG, structural genomics, PSI-2, protein structure initiative; 3.00A {Listeria innocua CLIP11262} SCOP: a.211.1.1 Back     alignment and structure
>2ogi_A Hypothetical protein SAG1661; NP_688652.1, conserved hypothetical protein TIGR00488, structural genomics; HET: GDP MES; 1.85A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>2pq7_A Predicted HD superfamily hydrolase; 104161995, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.45A {Uncultured thermotogales bacterium} SCOP: a.211.1.1 Back     alignment and structure
>2pjq_A Uncharacterized protein LP_2664; LPR71, NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Lactobacillus plantarum WCFS1} SCOP: a.211.1.1 Back     alignment and structure
>3dto_A BH2835 protein; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Bacillus halodurans} SCOP: a.211.1.1 Back     alignment and structure
>2o08_A BH1327 protein; putative HD superfamily hydrolase, structural genomics, JOIN for structural genomics, JCSG; HET: UNL PG4 DGI; 1.90A {Bacillus halodurans} Back     alignment and structure
>3djb_A Hydrolase, HD family; all alpha-helical protein., structural genomics, PSI-2, protein structure initiative; 2.90A {Bacillus thuringiensis serovarkonkukian} SCOP: a.211.1.1 Back     alignment and structure
>2qgs_A Protein Se1688; alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Staphylococcus epidermidis atcc 12228} SCOP: a.211.1.1 Back     alignment and structure
>3gw7_A Uncharacterized protein YEDJ; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Escherichia coli k-12} Back     alignment and structure
>3hc1_A Uncharacterized HDOD domain protein; HDOD domain protein with unknown function, structural genomics; 1.90A {Geobacter sulfurreducens} Back     alignment and structure
>1vqr_A Hypothetical protein CJ0248; 6967725, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.25A {Campylobacter jejuni subsp} SCOP: a.211.1.3 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 702 glycyl-tRNA synthetase subunit beta [Candidatus Liberib
d1f7ua1124 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {B 2e-04
>d1f7ua1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure

class: All alpha proteins
fold: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases
superfamily: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases
family: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases
domain: Arginyl-tRNA synthetase (ArgRS)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 41.9 bits (98), Expect = 2e-04
 Identities = 13/98 (13%), Positives = 34/98 (34%)

Query: 595 RIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLL 654
           R+  +        +E  +      L   A K L  ++  +   ++ ++       +   L
Sbjct: 12  RLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYL 71

Query: 655 HSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNII 692
             +   +   +D + V     E+   RL+L    + ++
Sbjct: 72  FKLTHQVSSCYDVLWVAGQTEELATARLALYGAARQVL 109


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target702 glycyl-tRNA synthetase subunit beta [Candidatus Liberib
d1f7ua1124 Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sacchar 98.51
d1iq0a1126 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [ 97.06
d2pjqa1215 Uncharacterized protein LP2664 {Lactobacillus plantarum 97.55
d2pq7a1217 Predicted hydrolase mes0020 {Uncultured thermotogales b 97.06
d3b57a1201 Uncharacterized protein Lin1889 {Listeria innocua [TaxI 96.9
d2qgsa1216 Uncharacterized protein SE1688 {Staphylococcus epidermi 96.59
d3dtoa1212 Uncharacterized protein BH2835 {Bacillus halodurans [Ta 96.29
d3djba1213 Uncharacterized protein BT9727_1981 {Bacillus thuringie 96.07
d1vqra_286 Hypothetical protein Cj0248 {Campylobacter jejuni [TaxI 93.16
d1r89a3180 tRNA nucleotidyltransferase, C-terminal domain {Archaeo 90.81
>d1f7ua1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases
superfamily: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases
family: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases
domain: Arginyl-tRNA synthetase (ArgRS)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=98.51  E-value=5.9e-07  Score=63.60  Aligned_cols=112  Identities=13%  Similarity=0.180  Sum_probs=93.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             38899999999998556531246777773856835989999999999999999998502538999999985327888751
Q gi|254781094|r  586 GEKFLLSAKRIFQILAIEEKKNREISLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSICEPIEIFF  665 (702)
Q Consensus       586 ~~~l~~a~KRv~NIL~~~~k~~~~~~~~vd~~Lf~~~~Ek~L~~~~~~~~~~i~~~l~~~dy~~~L~~L~~L~~~Id~FF  665 (702)
                      |.=+.=++-|+.+|+.+....+.......|.+++.+++|++|...+......+..+.....-......+.+|....+.|+
T Consensus         3 gpYiqYa~aRi~SIlrk~~~~~~~~~~~~~~~~l~~~~e~~Li~~l~~~p~vl~~a~~~~~Ph~l~~yl~~La~~F~~fY   82 (124)
T d1f7ua1           3 GPYLQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLTHQVSSCY   82 (124)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTSCHHHHTTSCGGGCCSHHHHHHHHHHTTHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999999987337870320344322269999999999999889999999999989999999999999999998


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             02703688689999999999999999986068
Q gi|254781094|r  666 DQVLVNVDDREVRDNRLSLLQYIKNIILIVIN  697 (702)
Q Consensus       666 DnVmVm~eD~~IR~NRL~LL~~i~~~f~~iaD  697 (702)
                      ++..|.++|++++..||.|+..++..+....+
T Consensus        83 ~~~~Il~~~~~~~~~RL~L~~~~~~vL~~gL~  114 (124)
T d1f7ua1          83 DVLWVAGQTEELATARLALYGAARQVLYNGMR  114 (124)
T ss_dssp             HHCCSTTSCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             76636799999999999999999999999865



>d1iq0a1 a.27.1.1 (A:467-592) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pjqa1 a.211.1.1 (A:1-215) Uncharacterized protein LP2664 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2pq7a1 a.211.1.1 (A:1-217) Predicted hydrolase mes0020 {Uncultured thermotogales bacterium [TaxId: 221214]} Back     information, alignment and structure
>d3b57a1 a.211.1.1 (A:1-201) Uncharacterized protein Lin1889 {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d2qgsa1 a.211.1.1 (A:1-216) Uncharacterized protein SE1688 {Staphylococcus epidermidis [TaxId: 1282]} Back     information, alignment and structure
>d3dtoa1 a.211.1.1 (A:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d3djba1 a.211.1.1 (A:2-214) Uncharacterized protein BT9727_1981 {Bacillus thuringiensis [TaxId: 1428]} Back     information, alignment and structure
>d1vqra_ a.211.1.3 (A:) Hypothetical protein Cj0248 {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1r89a3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 702 glycyl-tRNA synthetase subunit beta [Candidatus Li
2zue_A_92-112_499-629152 (A:92-112,A:499-629) Arginyl-tRNA synthetase; amin 2e-11
3fnr_A_1-24_332-464157 (A:1-24,A:332-464) Arginyl-tRNA synthetase; transf 0.004
3hc1_A_1-25_111-305220 (A:1-25,A:111-305) Uncharacterized HDOD domain pro 1e-10
1f7u_A_116-136_513-607116 (A:116-136,A:513-607) Arginyl-tRNA synthetase; RNA 5e-10
3gw7_A_1-131131 (A:1-131) Uncharacterized protein YEDJ; all alpha- 2e-06
>2zue_A (A:92-112,A:499-629) Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_ALength = 152 Back     alignment and structure
 Score = 65.8 bits (160), Expect = 2e-11
 Identities = 28/128 (21%), Positives = 53/128 (41%), Gaps = 7/128 (5%)

Query: 581 FSSAKGE--KFLLSA-KRIFQIL--AIEEKKNR--EISLEISPQYLLLEAEKRLYAVISD 633
           F S +GE   ++  A  R   IL  A EE      E   + +    L E E+ L  ++S 
Sbjct: 19  FGSFEGESAPYIQYAHARCSSILRKAEEEGIKVDPETLFKNADFTKLSERERELVIMLSK 78

Query: 634 FGTHIQESMDHKRYHQIGDLLHSICEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIIL 693
           F   ++++    + H I    + +      F+    V   +  VR+ RL L+  ++ ++ 
Sbjct: 79  FPRIVEQAGKDVKPHLIAWFANELASLFNKFYMDHPVLKAEEGVREARLLLVMAVEQVLK 138

Query: 694 IVINVQKI 701
             + +  I
Sbjct: 139 NALYLMGI 146


>3fnr_A (A:1-24,A:332-464) Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.20A {Campylobacter jejuni}Length = 157 Back     alignment and structure
>3hc1_A (A:1-25,A:111-305) Uncharacterized HDOD domain protein; HDOD domain protein with unknown function, structural genomics; 1.90A {Geobacter sulfurreducens}Length = 220 Back     alignment and structure
>1f7u_A (A:116-136,A:513-607) Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation, ligase, ligase/RNA complex; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae}Length = 116 Back     alignment and structure
>3gw7_A (A:1-131) Uncharacterized protein YEDJ; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Escherichia coli k-12}Length = 131 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target702 glycyl-tRNA synthetase subunit beta [Candidatus Liberib
2zue_A_92-112_499-629152 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase 99.61
1f7u_A_116-136_513-607116 Arginyl-tRNA synthetase; RNA-protein complex, amin 99.4
3fnr_A_1-24_332-464157 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX 96.95
3gw7_A_1-131131 Uncharacterized protein YEDJ; all alpha-helical pr 98.9
3dto_A_1-126126 BH2835 protein; all alpha-helical protein, structu 98.62
3djb_A_1-126126 Hydrolase, HD family; all alpha-helical protein., 98.21
3i7a_A_1-23_106-281199 Putative metal-dependent phosphohydrolase; YP_9268 97.45
2qgs_A_1-128128 Protein Se1688; alpha-helical protein, structural 97.45
2o08_A_1-134134 BH1327 protein; NP_242193.1, hypothetical protein, 97.32
2pq7_A_220 Predicted HD superfamily hydrolase; 104161995, HD 97.13
2ogi_A_1-159159 Hypothetical protein SAG1661; NP_688652.1, conserv 95.75
3ccg_A_1-135135 HD superfamily hydrolase; NP_347894.1, HD domain, 95.5
2pjq_A_231 Uncharacterized protein LP_2664; LPR71, NESG, stru 95.08
2paq_A_201 5'-deoxynucleotidase YFBR; HD domain phosphohydrol 94.26
3kh1_A_23-200178 Predicted metal-dependent phosphohydrolase; struct 92.06
3hc1_A_1-25_111-305220 Uncharacterized HDOD domain protein; HDOD domain p 98.85
1vqr_A_297 Hypothetical protein CJ0248; 6967725, structural g 95.42
3b57_A_209 LIN1889 protein; Q92AN1, X-RAY, NESG, structural g 97.67
>2zue_A (A:92-112,A:499-629) Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Back     alignment and structure
Probab=99.61  E-value=6.7e-15  Score=120.61  Aligned_cols=120  Identities=17%  Similarity=0.212  Sum_probs=105.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCC----CCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             19513889999999999855653124677----77738568359899999999999999999985025389999999853
Q gi|254781094|r  582 SSAKGEKFLLSAKRIFQILAIEEKKNREI----SLEISPQYLLLEAEKRLYAVISDFGTHIQESMDHKRYHQIGDLLHSI  657 (702)
Q Consensus       582 ~~~~~~~l~~a~KRv~NIL~~~~k~~~~~----~~~vd~~Lf~~~~Ek~L~~~~~~~~~~i~~~l~~~dy~~~L~~L~~L  657 (702)
                      +.+.+..+.-+|+|+.||+.+........    ..++|.++|.+++|++|+..+..+...+..+.+..+|..++..|.+|
T Consensus        23 ~~n~g~yIqYa~aRi~sIlrK~~~~~~~~~~~~~~~~d~~ll~~~~E~~L~~~l~~~~~~i~~a~~~~~p~~l~~~L~~L  102 (152)
T 2zue_A           23 EGESAPYIQYAHARCSSILRKAEEEGIKVDPETLFKNADFTKLSERERELVIMLSKFPRIVEQAGKDVKPHLIAWFANEL  102 (152)
T ss_dssp             SSSSHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHCCCSSCCHHHHHHHHHHHHHHHHHHHHHHTTCTHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             68985216689999999999866406788855642143343499999999999986899999999969808999999999


Q ss_pred             HHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHC
Q ss_conf             27888751027036886899999999999999999860684521
Q gi|254781094|r  658 CEPIEIFFDQVLVNVDDREVRDNRLSLLQYIKNIILIVINVQKI  701 (702)
Q Consensus       658 ~~~Id~FFDnVmVm~eD~~IR~NRL~LL~~i~~~f~~iaDfs~L  701 (702)
                      .++++.|||+|+||++|+++|+|||+|++.+++.+...+|+-.|
T Consensus       103 a~~~~~fyd~~~V~~ed~~i~~~RL~Ll~~v~~vl~~~l~lLGI  146 (152)
T 2zue_A          103 ASLFNKFYMDHPVLKAEEGVREARLLLVMAVEQVLKNALYLMGI  146 (152)
T ss_dssp             HHHHHHHHHHCCSTTSCTTHHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999639856899899999999999999999998651398



>1f7u_A (A:116-136,A:513-607) Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation, ligase, ligase/RNA complex; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3fnr_A (A:1-24,A:332-464) Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.20A {Campylobacter jejuni} Back     alignment and structure
>3gw7_A (A:1-131) Uncharacterized protein YEDJ; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Escherichia coli k-12} Back     alignment and structure
>3dto_A (A:1-126) BH2835 protein; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Bacillus halodurans} Back     alignment and structure
>3djb_A (A:1-126) Hydrolase, HD family; all alpha-helical protein., structural genomics, PSI-2, protein structure initiative; 2.90A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3i7a_A (A:1-23,A:106-281) Putative metal-dependent phosphohydrolase; YP_926882.1, structural genomics, joint center for structural genomics, JCSG; 2.06A {Shewanella amazonensis SB2B} Back     alignment and structure
>2qgs_A (A:1-128) Protein Se1688; alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2o08_A (A:1-134) BH1327 protein; NP_242193.1, hypothetical protein, structural genomics, joint center for structural genomics, JCSG, PSI-2; HET: UNL PG4 DGI; 1.90A {Bacillus halodurans} Back     alignment and structure
>2pq7_A (A:) Predicted HD superfamily hydrolase; 104161995, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.45A {Uncultured thermotogales bacterium} Back     alignment and structure
>2ogi_A (A:1-159) Hypothetical protein SAG1661; NP_688652.1, conserved hypothetical protein TIGR00488, structural genomics; HET: GDP MES; 1.85A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ccg_A (A:1-135) HD superfamily hydrolase; NP_347894.1, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2pjq_A (A:) Uncharacterized protein LP_2664; LPR71, NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2paq_A (A:) 5'-deoxynucleotidase YFBR; HD domain phosphohydrolase, structural genomics, PSI, protein structure initiative; 2.10A {Escherichia coli K12} Back     alignment and structure
>3kh1_A (A:23-200) Predicted metal-dependent phosphohydrolase; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.37A {Magnetospirillum magnetotacticum ms-1} Back     alignment and structure
>3hc1_A (A:1-25,A:111-305) Uncharacterized HDOD domain protein; HDOD domain protein with unknown function, structural genomics; 1.90A {Geobacter sulfurreducens} Back     alignment and structure
>1vqr_A (A:) Hypothetical protein CJ0248; 6967725, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.25A {Campylobacter jejuni subsp} Back     alignment and structure
>3b57_A (A:) LIN1889 protein; Q92AN1, X-RAY, NESG, structural genomics, PSI-2, protein structure initiative; 3.00A {Listeria innocua CLIP11262} Back     alignment and structure