254781095

254781095

UDP-N-acetylenolpyruvoylglucosamine reductase

GeneID in NCBI database:8210120Locus tag:CLIBASIA_04985
Protein GI in NCBI database:254781095Protein Accession:YP_003065508.1
Gene range:-(1092920, 1093876)Protein Length:318aa
Gene description:UDP-N-acetylenolpyruvoylglucosamine reductase
COG prediction:[M] UDP-N-acetylmuramate dehydrogenase
KEGG prediction:murB; UDP-N-acetylenolpyruvoylglucosamine reductase (EC:1.1.1.158); K00075 UDP-N-acetylmuramate dehydrogenase [EC:1.1.1.158]
SEED prediction:UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)
Pathway involved in KEGG:Amino sugar and nucleotide sugar metabolism [PATH:las00520]
Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis;
Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF
ccccHHHHHHHHHHHHcccEEEEccccccccEEEEcccEEEEEEEccHHHHHHHHHHHHccccEEEEEcccEEEEccccccEEEEEEcccccEEEEEccccEEEEEccccHHHHHHHHHHcccccccHHcccccccccHHHHccccccccHHEEEEEEEEEcccccEEEEcHHHHccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccccEEEccccccHHHHHHHHccccccccccEEEcccccEEEEEcccccHHHHHHHHHHHHHHHHHHHccEEEEccEEEcccccHHHHHHHccc
ccHHHHHHHHHHHHHHHccccccccccccccEEEccccccEEEccccHHHHHHHHHHccccccEEEEEcccEEEEEcccccEEEEEEcccccEEEEEccccEEEEcccHHHHHHHHHHHHcccccEEEEccccccccHHHEEccccccccHHHEEEEEEEEcccccEEEEcHHHHccccEEcccccccEEEEEEEEcEEccHHHHHHHHHHHHHHHHHHccccccEEcccEcccccccHHHHHHHccccccEEccEEEcccccccEEEcccccHHHHHHHHHHHHHHHHHHHcccccEccEEEcccccccEccccccc
MIYGRISRLLRERGKQLRgkfqenfplkqitwfrtggnaevmfqpqdihDLKYFLTllpsdipitivglgsnilvrdAGIRGVVLRLsnagfsnievrNHCEMIVGARCSGKSLANSALrhgiggfhffygipgsiggaaymnaganncetSQYVVEVHgidrkgnqhvipreqlkyQYRSSEITKDLIITHVVlrgfpesqNIISAAIANVChhretvqpikektggstfknptghsAWQLIEKSgcrglefggakiSELHCNFMinadnatgydleylGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF
miygrisrllrergkqlrgkfqenfplkqITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIdrkgnqhvipreqLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHREtvqpikektggstfknpTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF
MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRhgiggfhffygipgSIggaaymnagannCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF
********LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQI*******
MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF
MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF
MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF
MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target318 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat
315122421316 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat 1 1e-143
190892581324 UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobiu 1 1e-102
209550172324 UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobiu 1 1e-102
86358448324 UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobiu 1 1e-101
325293463321 UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobact 1 1e-100
15889376321 UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobact 1 3e-99
227822649324 UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhiz 1 1e-96
163760788325 UDP-N-acetylenolpyruvoylglucosamine reductase [Hoeflea 1 5e-96
116253046324 UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobiu 1 7e-96
222086442324 UDP-N-acetylenolpyruvoylglucosamine reductase protein [ 1 9e-96
>gi|315122421|ref|YP_004062910.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 316 Back     alignment and organism information
 Score =  511 bits (1315), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 238/309 (77%), Positives = 273/309 (88%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
            R+R +QLRGKFQENFP+KQ+TWFRTGGNAE MFQP+DIHDLKYFLTLLP+DI ITIVGL
Sbjct: 8   FRKRVQQLRGKFQENFPMKQVTWFRTGGNAEFMFQPKDIHDLKYFLTLLPNDITITIVGL 67

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSNILVRDAGI+GVVLRLS++GFS IE+++ CE++VGA CSGK LAN A+ HGIGG HFF
Sbjct: 68  GSNILVRDAGIKGVVLRLSHSGFSQIEMKSDCEIVVGASCSGKFLANWAMHHGIGGLHFF 127

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           YGIPGSIGGA YMNAGANNCETSQ VVEVH +DR GNQH+IP+ ++ YQYR S + KD I
Sbjct: 128 YGIPGSIGGAVYMNAGANNCETSQCVVEVHAMDRMGNQHIIPQNKMGYQYRHSLLPKDYI 187

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           ITHV L+GFPESQ++I +AI+ V  HR+TVQPIKEKTGGSTFKNP GHSAW+LIE+S CR
Sbjct: 188 ITHVFLKGFPESQDVIRSAISTVSVHRQTVQPIKEKTGGSTFKNPMGHSAWKLIEESQCR 247

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
           GLEFGGAKISELHCNFMIN  NATGYDLEYLGE VRKKV  ++GI+LEWEIKRLG+F DH
Sbjct: 248 GLEFGGAKISELHCNFMINTGNATGYDLEYLGELVRKKVLKKTGIVLEWEIKRLGEFVDH 307

Query: 310 QIVDATKIF 318
           +I+D T IF
Sbjct: 308 RIIDDTTIF 316


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190892581|ref|YP_001979123.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli CIAT 652] Length = 324 Back     alignment and organism information
>gi|209550172|ref|YP_002282089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 324 Back     alignment and organism information
>gi|86358448|ref|YP_470340.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli CFN 42] Length = 324 Back     alignment and organism information
>gi|325293463|ref|YP_004279327.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium sp. H13-3] Length = 321 Back     alignment and organism information
>gi|15889376|ref|NP_355057.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium tumefaciens str. C58] Length = 321 Back     alignment and organism information
>gi|227822649|ref|YP_002826621.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium fredii NGR234] Length = 324 Back     alignment and organism information
>gi|163760788|ref|ZP_02167868.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hoeflea phototrophica DFL-43] Length = 325 Back     alignment and organism information
>gi|116253046|ref|YP_768884.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 324 Back     alignment and organism information
>gi|222086442|ref|YP_002544976.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein [Agrobacterium radiobacter K84] Length = 324 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target318 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat
PRK13905298 PRK13905, murB, UDP-N-acetylenolpyruvoylglucosamine red 1e-113
PRK14652302 PRK14652, PRK14652, UDP-N-acetylenolpyruvoylglucosamine 8e-46
TIGR00179284 TIGR00179, murB, UDP-N-acetylenolpyruvoylglucosamine re 4e-45
PRK13906307 PRK13906, murB, UDP-N-acetylenolpyruvoylglucosamine red 4e-43
PRK14653297 PRK14653, PRK14653, UDP-N-acetylenolpyruvoylglucosamine 7e-39
PRK12436305 PRK12436, PRK12436, UDP-N-acetylenolpyruvoylglucosamine 3e-35
PRK14649295 PRK14649, PRK14649, UDP-N-acetylenolpyruvoylglucosamine 5e-33
PRK14651273 PRK14651, PRK14651, UDP-N-acetylenolpyruvoylglucosamine 5e-32
PRK14650302 PRK14650, PRK14650, UDP-N-acetylenolpyruvoylglucosamine 5e-27
PRK14648354 PRK14648, PRK14648, UDP-N-acetylenolpyruvoylglucosamine 6e-21
PRK00046334 PRK00046, murB, UDP-N-acetylenolpyruvoylglucosamine red 6e-14
COG0812291 COG0812, MurB, UDP-N-acetylmuramate dehydrogenase [Cell 1e-84
PRK13904257 PRK13904, murB, UDP-N-acetylenolpyruvoylglucosamine red 4e-30
pfam02873103 pfam02873, MurB_C, UDP-N-acetylenolpyruvoylglucosamine 2e-27
PRK13903363 PRK13903, murB, UDP-N-acetylenolpyruvoylglucosamine red 7e-15
pfam01565138 pfam01565, FAD_binding_4, FAD binding domain 8e-09
>gnl|CDD|184385 PRK13905, murB, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|173115 PRK14652, PRK14652, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|161747 TIGR00179, murB, UDP-N-acetylenolpyruvoylglucosamine reductase Back     alignment and domain information
>gnl|CDD|184386 PRK13906, murB, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|173116 PRK14653, PRK14653, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|171497 PRK12436, PRK12436, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|173112 PRK14649, PRK14649, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|184781 PRK14651, PRK14651, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|173113 PRK14650, PRK14650, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|173111 PRK14648, PRK14648, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|178820 PRK00046, murB, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|31154 COG0812, MurB, UDP-N-acetylmuramate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|184384 PRK13904, murB, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|111727 pfam02873, MurB_C, UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain Back     alignment and domain information
>gnl|CDD|184383 PRK13903, murB, UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>gnl|CDD|144965 pfam01565, FAD_binding_4, FAD binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 318 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat
PRK13905298 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 100.0
PRK13906307 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 100.0
PRK12436305 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisio 100.0
COG0812291 MurB UDP-N-acetylmuramate dehydrogenase [Cell envelope 100.0
PRK00046348 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 100.0
PRK13903359 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 100.0
PRK13904257 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 100.0
TIGR00179327 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Int 100.0
pfam02873103 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C 100.0
PRK11230 499 glycolate oxidase subunit GlcD; Provisional 99.68
KOG1232 511 consensus 98.72
TIGR02963515 xanthine_xdhA xanthine dehydrogenase, small subunit; In 97.72
TIGR01676 541 GLDHase galactonolactone dehydrogenase; InterPro: IPR01 96.45
COG4630493 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FA 90.31
pfam01565138 FAD_binding_4 FAD binding domain. This family consists 99.68
pfam00941171 FAD_binding_5 FAD binding domain in molybdopterin dehyd 97.71
PRK09971292 xanthine dehydrogenase subunit XdhB; Provisional 97.37
TIGR03195321 4hydrxCoA_B 4-hydroxybenzoyl-CoA reductase, beta subuni 97.12
TIGR03312257 Se_sel_red_FAD probable selenate reductase, FAD-binding 95.43
PRK09799258 putative selenate reductase subunit YgfM; Provisional 94.35
TIGR03199264 pucC xanthine dehydrogenase C subunit. This gene has be 94.21
COG0277 459 GlcD FAD/FMN-containing dehydrogenases [Energy producti 99.56
PRK11282351 glcE glycolate oxidase FAD binding subunit; Provisional 99.5
TIGR00387 437 glcD glycolate oxidase, subunit GlcD; InterPro: IPR0044 99.32
TIGR01678 505 FAD_lactone_ox sugar 1,4-lactone oxidases; InterPro: IP 99.21
KOG1231 505 consensus 99.05
KOG4730 518 consensus 99.01
TIGR01679 426 bact_FAD_ox FAD-linked oxidoreductase; InterPro: IPR010 98.64
TIGR01677 577 pln_FAD_oxido plant-specific FAD-dependent oxidoreducta 98.56
KOG1233 613 consensus 98.47
KOG0430 1257 consensus 96.61
COG1319284 CoxM Aerobic-type carbon monoxide dehydrogenase, middle 95.9
PRK11183 565 D-lactate dehydrogenase; Provisional 92.46
>PRK13905 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK13906 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK12436 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>COG0812 MurB UDP-N-acetylmuramate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00046 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK13903 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK13904 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>TIGR00179 murB UDP-N-acetylenolpyruvoylglucosamine reductase; InterPro: IPR003170 Members of this family are UDP-N-acetylenolpyruvoylglucosamine reductase enzymes, which are also called UDP-N-acetylmuramate dehydrogenases Back     alignment and domain information
>pfam02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain Back     alignment and domain information
>PRK11230 glycolate oxidase subunit GlcD; Provisional Back     alignment and domain information
>KOG1232 consensus Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit; InterPro: IPR014307 Members of this protein are the small subunit (or, in eukaryotes, the N-terminal domain) of xanthine dehydrogenase, an enzyme of purine catabolism via urate Back     alignment and domain information
>TIGR01676 GLDHase galactonolactone dehydrogenase; InterPro: IPR010029 This entry identifies L-galactono-gamma-lactone dehydrogenase 1 Back     alignment and domain information
>COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam01565 FAD_binding_4 FAD binding domain Back     alignment and domain information
>pfam00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase Back     alignment and domain information
>PRK09971 xanthine dehydrogenase subunit XdhB; Provisional Back     alignment and domain information
>TIGR03195 4hydrxCoA_B 4-hydroxybenzoyl-CoA reductase, beta subunit Back     alignment and domain information
>TIGR03312 Se_sel_red_FAD probable selenate reductase, FAD-binding subunit Back     alignment and domain information
>PRK09799 putative selenate reductase subunit YgfM; Provisional Back     alignment and domain information
>TIGR03199 pucC xanthine dehydrogenase C subunit Back     alignment and domain information
>COG0277 GlcD FAD/FMN-containing dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK11282 glcE glycolate oxidase FAD binding subunit; Provisional Back     alignment and domain information
>TIGR00387 glcD glycolate oxidase, subunit GlcD; InterPro: IPR004490 The glc locus of Escherichia coli encodes the subunits of glycolate oxidase and the glc regulator protein Back     alignment and domain information
>TIGR01678 FAD_lactone_ox sugar 1,4-lactone oxidases; InterPro: IPR010031 This entry identifies a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesising ascorbic acid or a derivative Back     alignment and domain information
>KOG1231 consensus Back     alignment and domain information
>KOG4730 consensus Back     alignment and domain information
>TIGR01679 bact_FAD_ox FAD-linked oxidoreductase; InterPro: IPR010032 This entry identifies a family of bacterial oxidoreductases with covalently linked FAD, closely related to two different eukaryotic oxidases, L-gulonolactone oxidase (1 Back     alignment and domain information
>TIGR01677 pln_FAD_oxido plant-specific FAD-dependent oxidoreductase; InterPro: IPR010030 This entry identifies a family of uncharacterised plant-specific FAD-dependent oxidoreductases Back     alignment and domain information
>KOG1233 consensus Back     alignment and domain information
>KOG0430 consensus Back     alignment and domain information
>COG1319 CoxM Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM homologs [Energy production and conversion] Back     alignment and domain information
>PRK11183 D-lactate dehydrogenase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target318 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat
1hsk_A326 Crystal Structure Of S. Aureus Murb Length = 326 4e-53
3i99_A357 The Crystal Structure Of The Udp-N- Acetylenolpyruv 4e-39
2q85_A342 Crystal Structure Of E. Coli Mur B Bound To A Napht 1e-38
2mbr_A340 Murb Wild Type, Complex With Enolpyruvyl-Udp-N- Ace 7e-38
1uxy_A340 Murb Mutant With Ser 229 Replaced By Ala, Complex W 1e-37
2gqt_A268 Crystal Structure Of Udp-N-Acetylenolpyruvylglucosa 2e-30
>gi|13787122|pdb|1HSK|A Chain A, Crystal Structure Of S. Aureus Murb Length = 326 Back     alignment and structure
 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 96/312 (30%), Positives = 161/312 (51%), Gaps = 7/312 (2%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PS 60
           I   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     +
Sbjct: 14  INKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQN 71

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++  A  
Sbjct: 72  EIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDA---IIAGSGAAIIDVSRVARD 128

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  YR
Sbjct: 129 YALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYR 188

Query: 181 SSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH A
Sbjct: 189 NSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFA 248

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  E
Sbjct: 249 GKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNRE 308

Query: 300 IKRLGDFFDHQI 311
           ++ +G+     +
Sbjct: 309 VRIIGEHPKESL 320


>gi|261824992|pdb|3I99|A Chain A, The Crystal Structure Of The Udp-N- Acetylenolpyruvoylglucosamine Reductase From The Vibrio Cholerae O1 Biovar Tor Length = 357 Back     alignment and structure
gi|151567952|pdb|2Q85|A Chain A, Crystal Structure Of E. Coli Mur B Bound To A Naphthyl Tetronic Acid Inihibitor Length = 342 Back     alignment and structure
>gi|157835335|pdb|2MBR|A Chain A, Murb Wild Type, Complex With Enolpyruvyl-Udp-N- Acetylglucosamine Length = 340 Back     alignment and structure
>gi|157834106|pdb|1UXY|A Chain A, Murb Mutant With Ser 229 Replaced By Ala, Complex With Enolpyruvyl-Udp-N-Acetylglucosamine Length = 340 Back     alignment and structure
>gi|122920334|pdb|2GQT|A Chain A, Crystal Structure Of Udp-N-Acetylenolpyruvylglucosamine Reductase (Murb) From Thermus Caldophilus Length = 268 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target318 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat
1hsk_A326 UDP-N-acetylenolpyruvoylglucosamine reductase; peptidog 2e-68
3i99_A357 UDP-N-acetylenolpyruvoylglucosamine reductase; oxidored 4e-50
2gqt_A268 UDP-N-acetylenolpyruvylglucosamine reductase; peptidogl 1e-47
1uxy_A340 MURB, uridine diphospho-N-acetylenolpyruvylglucosamine 5e-45
>1hsk_A UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus} SCOP: d.145.1.2 d.146.1.1 Length = 326 Back     alignment and structure
 Score =  254 bits (649), Expect = 2e-68
 Identities = 99/303 (32%), Positives = 164/303 (54%), Gaps = 7/303 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
           I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+
Sbjct: 18  IYQALQQLIP--NEKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPV 75

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T +G GSNI++R+ GIRG+V+ L +    +IEV +   +I G+  +   ++  A  + + 
Sbjct: 76  TYLGNGSNIIIREGGIRGIVISLLS--LDHIEVSDDA-IIAGSGAAIIDVSRVARDYALT 132

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I
Sbjct: 133 GLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSII 192

Query: 185 TKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            K+ L++        P     I A + ++   RE+ QP++  + GS F+ P GH A +LI
Sbjct: 193 QKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLI 252

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +
Sbjct: 253 QDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRII 312

Query: 304 GDF 306
           G+ 
Sbjct: 313 GEH 315


>3i99_A UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae} Length = 357 Back     alignment and structure
>2gqt_A UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A* Length = 268 Back     alignment and structure
>1uxy_A MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli} SCOP: d.145.1.2 d.146.1.1 PDB: 1mbb_A* 1mbt_A* 2q85_A* 2mbr_A* Length = 340 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target318 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat
1hsk_A326 UDP-N-acetylenolpyruvoylglucosamine reductase; peptidog 100.0
3i99_A357 UDP-N-acetylenolpyruvoylglucosamine reductase; oxidored 100.0
1uxy_A340 MURB, uridine diphospho-N-acetylenolpyruvylglucosamine 100.0
2gqt_A268 UDP-N-acetylenolpyruvylglucosamine reductase; peptidogl 100.0
2uuu_A 584 Alkyldihydroxyacetonephosphate synthase; rhizomelic cho 99.65
1e8g_A 560 Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, 99.51
2exr_A 524 Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxida 99.5
2bvf_A 459 6-hydroxy-D-nicotine oxidase; autoflavinylation, enanti 99.49
2ipi_A 521 Aclacinomycin oxidoreductase (aknox); anthracycline, fl 99.49
1w1o_A 534 Cytokinin dehydrogenase 1; flavin, oxidoreductase, flav 99.48
3fw9_A 495 Reticuline oxidase; BI-covalent flavinylation, N-glycos 99.48
2i0k_A 561 Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzy 99.45
3js8_A 540 Cholesterol oxidase; cholsterol, organic solvent stabil 99.44
1zr6_A 503 Glucooligosaccharide oxidase; alpha + beta, flavoenzyme 99.42
2wdx_A 523 Putative hexose oxidase; oxidoreductase-antibiotic comp 99.41
2vfr_A 422 Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, f 99.41
1rm6_B324 4-hydroxybenzoyl-COA reductase beta subunit; xanthine o 98.06
3nrz_B305 Xanthine dehydrogenase/oxidase; xanthine oxidase, hypox 97.98
1ffv_C287 CUTM, flavoprotein of carbon monoxide dehydrogenase; hy 97.96
2w3s_A462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, ir 97.85
3hrd_C296 Nicotinate dehydrogenase FAD-subunit; selenium ligand, 97.72
1v97_A 1332 XD, xanthine dehydrogenase; molybdopterin, FYX-051, rea 97.68
1n62_C288 Carbon monoxide dehydrogenase medium chain; CODH, coppe 97.62
1t3q_C288 Quinoline 2-oxidoreductase medium subunit; QOR, molybde 97.6
1wvf_A 520 4-cresol dehydrogenase [hydroxylating] flavoprotein sub 99.58
1f0x_A 571 DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD 99.46
2yvs_A219 Glycolate oxidase subunit GLCE; oxidoreductase; 2.00A { 98.09
>1hsk_A UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus} SCOP: d.145.1.2 d.146.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=669.97  Aligned_cols=304  Identities=33%  Similarity=0.535  Sum_probs=281.3

Q ss_pred             HHHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCEEEEEEEECCHHHHHHHHHHHH-CCCCEEEECCCCEEEEECCCEEC
Q ss_conf             79999999998750662775488001522576614889999689899999999856-29989998475203660488402
Q gi|254781095|r    4 GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRG   82 (318)
Q Consensus         4 ~~~~~~l~~~~~~~~g~i~~n~~L~~~tt~rvGG~A~~~~~p~s~~el~~~l~~~~-~~~p~~iiG~GSNil~~D~~~~G   82 (318)
                      +.+.+.|+..+.  +.+|+.|+||++||||||||+|++|++|+|.+||.+++++++ +++|+++||+|||+||+|++|+|
T Consensus        16 ~~~~~~l~~~~~--~~~i~~n~pLs~~tT~riGG~A~~~~~~~s~~dL~~~l~~~~~~~~p~~vLG~GSNlL~~D~g~~G   93 (326)
T 1hsk_A           16 KDIYQALQQLIP--NEKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRG   93 (326)
T ss_dssp             HHHHHHHHHHSC--GGGEEEEEEGGGTCTTSCCCEEEEEECCSSHHHHHHHHHHHHHTTCCEEEESSCSSEEECTTCEEE
T ss_pred             HHHHHHHHHHCC--CCCEEECCCCCCCCEEEECCEEEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCEEEECCCCCC
T ss_conf             999999996576--574881786766637335808889997599999999999998749988999076415773589874


Q ss_pred             CHHHHCCCCCCCEEEECCCCCCCCCEEEHHHHHHHHHHHHCCCHHCCCCHHHHHHHHHCCCCCCCCCEEEEEEEEEEEEC
Q ss_conf             20221123443113302665123311221567777887520120003872566324311573215831345666434411
Q gi|254781095|r   83 VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGID  162 (318)
Q Consensus        83 ~vI~l~~~~~~~i~~~~~~~i~v~AG~~~~~l~~~~~~~gl~GlE~l~gIPGTVGGAi~mNAGayG~ei~d~i~~V~~~d  162 (318)
                      +||++..  +..++..+ ..++|+||+.|++|++++.++||+|||||+|||||||||++|||||||.|++|+|++|+++|
T Consensus        94 vVI~l~~--~~~~~~~~-~~v~~~aG~~~~~lv~~~~~~gl~GlE~L~gIPGTVGgAv~mNaGayG~ei~d~l~~V~~~d  170 (326)
T 1hsk_A           94 IVISLLS--LDHIEVSD-DAIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVN  170 (326)
T ss_dssp             EEEECTT--CCCEEEET-TEEEEETTSBHHHHHHHHHHTTEESCGGGTTCCSBHHHHHHHTCEETTEEHHHHEEEEEEEC
T ss_pred             EEEEECC--CCCEEECC-CEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEEEEEEEEEE
T ss_conf             4998514--68388326-33899718797999999997587683135556750467775147888507041788889983


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCC-CCCEEEEECCCCCCCCCCCHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCHH
Q ss_conf             232100001233443100232246-7620010023545654310012221001100015566704658897278985100
Q gi|254781095|r  163 RKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ  241 (318)
Q Consensus       163 ~~g~~~~l~~~e~~f~YR~S~~~~-~~iIl~a~l~l~~~~~~~i~~~~~~~~~~R~~~qP~~~~s~GSvFkNP~~~~A~~  241 (318)
                      .+|++.+++++||+|+||+|.|++ .++++.+.|.+.+.+++.+++.|.++..+|+++||...||||||||||++.+|||
T Consensus       171 ~~g~~~~~~~~e~~F~YR~S~fk~~~~ii~~~~~~~~~~~~~~~~~~~~~~~~~R~~~qP~~~p~~GS~FkNp~~~~Ag~  250 (326)
T 1hsk_A          171 EQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGK  250 (326)
T ss_dssp             TTSCEEEEETTTTTCBTTBCHHHHTTCEEEEEEEECEECCHHHHHHHHHHHHHHHHHHSCTTSCEECCCBCCCTTSCHHH
T ss_pred             CCCCEEEECCCEEEEEECCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             28948871123022311156667667524568998636732567787779987764269998898874146889842799


Q ss_pred             HHHHCCCCCCCCCCEEECCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCEEEECCEEEECCCCHHHHH
Q ss_conf             026318688206677871567708996899799999999999999999984754004228962168356888
Q gi|254781095|r  242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD  313 (318)
Q Consensus       242 LIe~~GlKG~~iG~a~vS~kHanfivN~g~ata~di~~Li~~v~~~V~~~~gi~Le~Ev~~iG~f~~~~~~~  313 (318)
                      |||+|||||+++|+|+||+||||||||.|+|||+||++|+++||++|+++|||.||+||++||+| +++-|+
T Consensus       251 LIe~~GlKG~~iG~a~vS~kHanfivN~g~ata~di~~Li~~i~~~V~~~fGI~Le~Ev~iiG~~-~~~~~~  321 (326)
T 1hsk_A          251 LIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGEH-PKESLQ  321 (326)
T ss_dssp             HHHHTTCTTCEETTEEECSSCTTCEEECSSCCHHHHHHHHHHHHHHHHHHHSCCCCBCSEEESCC-CC----
T ss_pred             HHHHHCCCCCEECCEEEECCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCEECCEEECCC-CCCCCC
T ss_conf             99970888875639798335798899899979999999999999999998898030773997789-853476



>3i99_A UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae} Back     alignment and structure
>1uxy_A MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli} SCOP: d.145.1.2 d.146.1.1 PDB: 1mbb_A* 1mbt_A* 2q85_A* 2mbr_A* Back     alignment and structure
>2gqt_A UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A* Back     alignment and structure
>2uuu_A Alkyldihydroxyacetonephosphate synthase; rhizomelic chondrodysplasia punctata, biosynthesis of phospholipids, flavoprotein; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Back     alignment and structure
>1e8g_A Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} SCOP: d.58.32.1 d.145.1.1 PDB: 1e8f_A* 1e8h_A* 1qlt_A* 1qlu_A* 1vao_A* 1ahv_A* 1ahz_A* 1ahu_A* 2vao_A* 1w1j_A* 1dzn_A* 1w1l_A* 1e0y_A* 1w1k_A* 1w1m_A* Back     alignment and structure
>2exr_A Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structural genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A* Back     alignment and structure
>2bvf_A 6-hydroxy-D-nicotine oxidase; autoflavinylation, enantiomeric substrates, flavoenzymes, nicotine degradation; HET: FAD; 1.92A {Arthrobacter nicotinovorans} PDB: 2bvg_A* 2bvh_A* Back     alignment and structure
>2ipi_A Aclacinomycin oxidoreductase (aknox); anthracycline, flavoenzyme, twinning, MAD; HET: AKY FAD; 1.65A {Streptomyces galilaeus} Back     alignment and structure
>1w1o_A Cytokinin dehydrogenase 1; flavin, oxidoreductase, flavoprotein, FAD; HET: NAG FAD; 1.7A {Zea mays} SCOP: d.58.32.4 d.145.1.1 PDB: 1w1q_A* 1w1r_A* 1w1s_A* 3dq0_A* 2qkn_A* 3c0p_A* 3bw7_A* 2qpm_A* 3kjm_A* Back     alignment and structure
>3fw9_A Reticuline oxidase; BI-covalent flavinylation, N-glycosylation, alakloid biosynthesis, oxidoreductase, alkaloid metabolism; HET: FAD SLX NAG MAN; 1.49A {Eschscholzia californica} PDB: 3d2h_A* 3d2d_A* 3d2j_A* 3gsy_A* 3fw8_A* 3fw7_A* 3fwa_A* Back     alignment and structure
>2i0k_A Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzyme; HET: FAD; 1.60A {Brevibacterium sterolicum} SCOP: d.58.32.3 d.145.1.1 PDB: 1i19_A* Back     alignment and structure
>3js8_A Cholesterol oxidase; cholsterol, organic solvent stability, oxygen channel, FAD, flavoprotein, oxidoreductase; HET: FAD SUC; 1.54A {Chromobacterium SP} Back     alignment and structure
>1zr6_A Glucooligosaccharide oxidase; alpha + beta, flavoenzyme, oxidoreductase; HET: NAG FAD; 1.55A {Acremonium strictum} PDB: 2axr_A* 3e0t_A* 3hsu_A* Back     alignment and structure
>2wdx_A Putative hexose oxidase; oxidoreductase-antibiotic complex; HET: FAD GHP 3MY 3FG OMY D3P BMA NAG BDP T55; 2.30A {Nonomuraea SP} PDB: 2wdw_A* Back     alignment and structure
>2vfr_A Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, flavin, flavoprotein, oxidoreductase; HET: FAD; 1.1A {Streptomyces coelicolor} PDB: 2vfs_A* 2vft_A* 2vfu_A* 2vfv_A* Back     alignment and structure
>1rm6_B 4-hydroxybenzoyl-COA reductase beta subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: d.87.2.1 d.145.1.3 PDB: 1sb3_B* Back     alignment and structure
>3nrz_B Xanthine dehydrogenase/oxidase; xanthine oxidase, hypoxanthine, substrate orientation, hydro oxidoreductase; HET: FAD MTE HPA; 1.80A {Bos taurus} PDB: 3eub_B* 3etr_B* 3ns1_B* Back     alignment and structure
>1ffv_C CUTM, flavoprotein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: d.87.2.1 d.145.1.3 PDB: 1ffu_C* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>3hrd_C Nicotinate dehydrogenase FAD-subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1v97_A XD, xanthine dehydrogenase; molybdopterin, FYX-051, reaction intermediate, oxidoreductase; HET: MTE FAD FYX; 1.94A {Bos taurus} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.87.2.1 d.133.1.1 d.145.1.3 PDB: 1fo4_A* 1vdv_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 2e3t_A* 1wyg_A* 3b9j_C* 1fiq_C* 3eub_C* 3etr_C* 1fiq_B* 3b9j_B* 3etr_B* 3eub_B* 3b9j_A* 1fiq_A* 3eub_A* 3etr_A* Back     alignment and structure
>1n62_C Carbon monoxide dehydrogenase medium chain; CODH, copper, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans OM5} SCOP: d.87.2.1 d.145.1.3 PDB: 1n5w_C* 1n61_C* 1n60_C* 1n63_C* 1zxi_C* Back     alignment and structure
>1t3q_C Quinoline 2-oxidoreductase medium subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: d.87.2.1 d.145.1.3 Back     alignment and structure
>1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit; electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} SCOP: d.58.32.1 d.145.1.1 PDB: 1wve_A* 1dii_A* 1diq_A* Back     alignment and structure
>1f0x_A DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: d.58.32.2 d.145.1.1 Back     alignment and structure
>2yvs_A Glycolate oxidase subunit GLCE; oxidoreductase; 2.00A {Thermus thermophilus HB8} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 318 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat
d1hska2109 d.146.1.1 (A:209-317) Uridine diphospho-N-Acetylenolpyr 3e-26
d1uxya2142 d.146.1.1 (A:201-342) Uridine diphospho-N-Acetylenolpyr 1e-19
d1hska1194 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyru 1e-23
d1uxya1198 d.145.1.2 (A:3-200) Uridine diphospho-N-Acetylenolpyruv 4e-19
>d1hska2 d.146.1.1 (A:209-317) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain
superfamily: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain
family: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain
domain: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain
species: Staphylococcus aureus [TaxId: 1280]
 Score =  112 bits (282), Expect = 3e-26
 Identities = 38/102 (37%), Positives = 58/102 (56%)

Query: 205 ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCN 264
           I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S  H  
Sbjct: 6   IQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTKHAG 65

Query: 265 FMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           FM+N DN T  D E L   V+K V  + GI L  E++ +G+ 
Sbjct: 66  FMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGEH 107


>d1uxya2 d.146.1.1 (A:201-342) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 142 Back     information, alignment and structure
>d1hska1 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} Length = 194 Back     information, alignment and structure
>d1uxya1 d.145.1.2 (A:3-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 198 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target318 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat
d1hska1194 Uridine diphospho-N-Acetylenolpyruvylglucosamine reduct 100.0
d1uxya1198 Uridine diphospho-N-Acetylenolpyruvylglucosamine reduct 100.0
d1wvfa2236 Flavoprotein subunit of p-cresol methylhydroxylase {Pse 99.66
d1w1oa2206 Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 457 99.61
d1f0xa2265 D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} 99.26
d1hska2109 Uridine diphospho-N-Acetylenolpyruvylglucosamine reduct 100.0
d1uxya2142 Uridine diphospho-N-Acetylenolpyruvylglucosamine reduct 100.0
d2i0ka2216 Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 99.62
d1rm6b2216 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-ter 98.21
d1n62c2177 Carbon monoxide (CO) dehydrogenase flavoprotein, N-term 98.18
d1v97a6223 Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId 98.11
d1ffvc2177 Carbon monoxide (CO) dehydrogenase flavoprotein, N-term 97.98
d1t3qc2176 Quinoline 2-oxidoreductase medium subunit QorM {Pseudom 97.77
d1jroa4167 Xanthine dehydrogenase chain A, domain 3 {Rhodobacter c 97.49
d1e8ga2268 Vanillyl-alcohol oxidase {Fungus (Penicillium simplicis 99.54
>d1hska1 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FAD-binding/transporter-associated domain-like
superfamily: FAD-binding/transporter-associated domain-like
family: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain
domain: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain
species: Staphylococcus aureus [TaxId: 1280]
Probab=100.00  E-value=0  Score=353.33  Aligned_cols=190  Identities=32%  Similarity=0.549  Sum_probs=172.3

Q ss_pred             HHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCEEEEEEEECCHHHHHHHHHHHH-CCCCEEEECCCCEEEEECCCEECC
Q ss_conf             9999999998750662775488001522576614889999689899999999856-299899984752036604884022
Q gi|254781095|r    5 RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGV   83 (318)
Q Consensus         5 ~~~~~l~~~~~~~~g~i~~n~~L~~~tt~rvGG~A~~~~~p~s~~el~~~l~~~~-~~~p~~iiG~GSNil~~D~~~~G~   83 (318)
                      .+-+.|+.++.+  .+++.|+||++|||||+||+|++|++|+|.+|+.+++++++ +++|++++|+|||++++|.+++|+
T Consensus         3 ~~~~~l~~~l~~--~~i~~~~~L~~~tt~~vGG~a~~~v~p~s~~el~~~~~~a~~~~ip~~v~G~GSNll~~d~~~~g~   80 (194)
T d1hska1           3 DIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGI   80 (194)
T ss_dssp             HHHHHHHHHSCG--GGEEEEEEGGGTCTTSCCCEEEEEECCSSHHHHHHHHHHHHHTTCCEEEESSCSSEEECTTCEEEE
T ss_pred             HHHHHHHHHCCC--CCEEECCCCHHCCEEEECEEEEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCEEE
T ss_conf             899999866683--637827840343271128298899951999999999987564365367860554223577872239


Q ss_pred             HHHHCCCCCCCEEEECCCCCCCCCEEEHHHHHHHHHHHHCCCHHCCCCHHHHHHHHHCCCCCCCCCEEEEEEEEEEEECC
Q ss_conf             02211234431133026651233112215677778875201200038725663243115732158313456664344112
Q gi|254781095|r   84 VLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDR  163 (318)
Q Consensus        84 vI~l~~~~~~~i~~~~~~~i~v~AG~~~~~l~~~~~~~gl~GlE~l~gIPGTVGGAi~mNAGayG~ei~d~i~~V~~~d~  163 (318)
                      ||++..  +..++..++ .++|+||+.|.++++++.++||+|+||++|||||||||++|||||||.|++|+|.+|+++++
T Consensus        81 vi~l~~--~~~~~~~~~-~v~~~aG~~~~~l~~~~~~~gl~g~e~~~gipgtvGGai~mNaG~yG~ei~d~v~~v~~v~~  157 (194)
T d1hska1          81 VISLLS--LDHIEVSDD-AIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNE  157 (194)
T ss_dssp             EEECTT--CCCEEEETT-EEEEETTSBHHHHHHHHHHTTEESCGGGTTCCSBHHHHHHHTCEETTEEHHHHEEEEEEECT
T ss_pred             EEEEEC--CCCCCCCCC-EEEEEECCCHHHHHHHHHHHCCCCCCCCCCCCEEEHHHHHCCCCCCCCEEEEEEEEEEEECC
T ss_conf             998202--222224697-69998356317888999861034332427766334545552574168417889999999948


Q ss_pred             CCCEEEECCCCCCCCCCCCCCCC-CCCEEEEECCCCC
Q ss_conf             32100001233443100232246-7620010023545
Q gi|254781095|r  164 KGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFP  199 (318)
Q Consensus       164 ~g~~~~l~~~e~~f~YR~S~~~~-~~iIl~a~l~l~~  199 (318)
                      +|++++++++||+|+||+|.|++ ++||++|+|+|.|
T Consensus       158 ~G~i~~l~~~e~~f~YR~s~~~~~~~iIl~a~f~L~P  194 (194)
T d1hska1         158 QGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTLAP  194 (194)
T ss_dssp             TSCEEEEETTTTTCBTTBCHHHHTTCEEEEEEEECEE
T ss_pred             CCCEEEEEHHHCCCCCCCCCCCCCCEEEEEEEEEEEC
T ss_conf             9989998789926307778799999999999999979



>d1uxya1 d.145.1.2 (A:3-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wvfa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w1oa2 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1f0xa2 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hska2 d.146.1.1 (A:209-317) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1uxya2 d.146.1.1 (A:201-342) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0ka2 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1rm6b2 d.145.1.3 (B:1-216) 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1n62c2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1v97a6 d.145.1.3 (A:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ffvc2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1t3qc2 d.145.1.3 (C:1-176) Quinoline 2-oxidoreductase medium subunit QorM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jroa4 d.145.1.3 (A:179-345) Xanthine dehydrogenase chain A, domain 3 {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1e8ga2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 318 UDP-N-acetylenolpyruvoylglucosamine reductase [Can
1hsk_A_231-30474 (A:231-304) UDP-N-acetylenolpyruvoylglucosamine re 8e-22
2gqt_A_199-26062 (A:199-260) UDP-N-acetylenolpyruvylglucosamine red 4e-19
3i99_A_277-33357 (A:277-333) UDP-N-acetylenolpyruvoylglucosamine re 7e-15
1uxy_A_273-31947 (A:273-319) MURB, uridine diphospho-N-acetylenolpy 3e-10
2gqt_A_1-69_261-26877 (A:1-69,A:261-268) UDP-N-acetylenolpyruvylglucosam 6e-18
3i99_A_1-82_334-357106 (A:1-82,A:334-357) UDP-N-acetylenolpyruvoylglucosa 9e-16
1uxy_A_1-66_320-34087 (A:1-66,A:320-340) MURB, uridine diphospho-N-acety 2e-14
1hsk_A_1-99_305-326121 (A:1-99,A:305-326) UDP-N-acetylenolpyruvoylglucosa 4e-11
1n62_C_1-176176 (C:1-176) Carbon monoxide dehydrogenase medium cha 4e-17
1ffv_C_1-176176 (C:1-176) CUTM, flavoprotein of carbon monoxide de 4e-05
1t3q_C_1-174174 (C:1-174) Quinoline 2-oxidoreductase medium subuni 0.004
1hsk_A_100-230131 (A:100-230) UDP-N-acetylenolpyruvoylglucosamine re 2e-13
2gqt_A_70-198129 (A:70-198) UDP-N-acetylenolpyruvylglucosamine redu 1e-12
1uxy_A_67-190124 (A:67-190) MURB, uridine diphospho-N-acetylenolpyr 9e-09
3i99_A_83-206124 (A:83-206) UDP-N-acetylenolpyruvoylglucosamine red 3e-08
>1hsk_A (A:231-304) UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus}Length = 74 Back     alignment and structure
 Score = 98.9 bits (247), Expect = 8e-22
 Identities = 29/73 (39%), Positives = 41/73 (56%)

Query: 222 IKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLG 281
           ++  + GS F+ P GH A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L 
Sbjct: 1   LEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLI 60

Query: 282 EQVRKKVFNQSGI 294
             V+K V  + GI
Sbjct: 61  HYVQKTVKEKFGI 73


>2gqt_A (A:199-260) UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A*Length = 62 Back     alignment and structure
>3i99_A (A:277-333) UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae}Length = 57 Back     alignment and structure
>1uxy_A (A:273-319) MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli}Length = 47 Back     alignment and structure
>2gqt_A (A:1-69,A:261-268) UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A*Length = 77 Back     alignment and structure
>3i99_A (A:1-82,A:334-357) UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae}Length = 106 Back     alignment and structure
>1uxy_A (A:1-66,A:320-340) MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli}Length = 87 Back     alignment and structure
>1hsk_A (A:1-99,A:305-326) UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus}Length = 121 Back     alignment and structure
>1n62_C (C:1-176) Carbon monoxide dehydrogenase medium chain; CODH, copper, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans OM5}Length = 176 Back     alignment and structure
>1ffv_C (C:1-176) CUTM, flavoprotein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava}Length = 176 Back     alignment and structure
>1t3q_C (C:1-174) Quinoline 2-oxidoreductase medium subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida}Length = 174 Back     alignment and structure
>1hsk_A (A:100-230) UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus}Length = 131 Back     alignment and structure
>2gqt_A (A:70-198) UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A*Length = 129 Back     alignment and structure
>1uxy_A (A:67-190) MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli}Length = 124 Back     alignment and structure
>3i99_A (A:83-206) UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae}Length = 124 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target318 UDP-N-acetylenolpyruvoylglucosamine reductase [Candidat
1hsk_A_231-30474 UDP-N-acetylenolpyruvoylglucosamine reductase; pep 99.96
2gqt_A_199-26062 UDP-N-acetylenolpyruvylglucosamine reductase; pept 99.89
3i99_A_277-33357 UDP-N-acetylenolpyruvoylglucosamine reductase; oxi 99.8
2gqt_A_70-198129 UDP-N-acetylenolpyruvylglucosamine reductase; pept 99.87
1hsk_A_100-230131 UDP-N-acetylenolpyruvoylglucosamine reductase; pep 99.84
1uxy_A_67-190124 MURB, uridine diphospho-N-acetylenolpyruvylglucosa 99.59
3i99_A_83-206124 UDP-N-acetylenolpyruvoylglucosamine reductase; oxi 99.5
2exr_A_116-238_483-524165 Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin 98.39
2uuu_A_194-315_549-584158 Alkyldihydroxyacetonephosphate synthase; rhizomeli 98.15
3i99_A_1-82_334-357106 UDP-N-acetylenolpyruvoylglucosamine reductase; oxi 99.73
2gqt_A_1-69_261-26877 UDP-N-acetylenolpyruvylglucosamine reductase; pept 99.71
1uxy_A_1-66_320-34087 MURB, uridine diphospho-N-acetylenolpyruvylglucosa 99.63
1hsk_A_1-99_305-326121 UDP-N-acetylenolpyruvoylglucosamine reductase; pep 99.16
1f0x_A_1-103103 DLDH, D-lactate dehydrogenase; oxidoreductase; HET 97.18
1wvf_A_1-112112 4-cresol dehydrogenase [hydroxylating] flavoprotei 97.02
2uuu_A_77-193117 Alkyldihydroxyacetonephosphate synthase; rhizomeli 97.02
1e8g_A_1-126126 Vanillyl-alcohol oxidase; oxidoreductase, flavoenz 96.69
2exr_A_1-115115 Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin 96.59
1zr6_A_1-9595 Glucooligosaccharide oxidase; alpha + beta, flavoe 96.55
3js8_A_1-8787 Cholesterol oxidase; cholsterol, organic solvent s 95.69
2ipi_A_1-237_481-521278 Aclacinomycin oxidoreductase (aknox); anthracyclin 99.71
1w1o_A_1-245_495-534285 Cytokinin dehydrogenase 1; flavin, oxidoreductase, 99.57
3fw9_A_1-218_456-495258 Reticuline oxidase; BI-covalent flavinylation, N-g 99.57
2bvf_A_1-204_412-459252 6-hydroxy-D-nicotine oxidase; autoflavinylation, e 99.67
1n62_C_1-176176 Carbon monoxide dehydrogenase medium chain; CODH, 99.66
2vfr_A_1-182182 Xylitol oxidase, alditol oxidase; FAD, sugar, poly 99.64
2i0k_A_1-220220 Oxidoreductase; MIX alpha beta, covalent FAD, flav 99.54
1ffv_C_1-176176 CUTM, flavoprotein of carbon monoxide dehydrogenas 98.93
1t3q_C_1-174174 Quinoline 2-oxidoreductase medium subunit; QOR, mo 98.39
1rm6_B_1-216216 4-hydroxybenzoyl-COA reductase beta subunit; xanth 98.0
2w3s_A_168-245_303-344120 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 94.2
1uxy_A_273-31947 MURB, uridine diphospho-N-acetylenolpyruvylglucosa 99.5
1zr6_A_96-211_452-503168 Glucooligosaccharide oxidase; alpha + beta, flavoe 98.83
1wvf_A_113-241129 4-cresol dehydrogenase [hydroxylating] flavoprotei 98.09
2yvs_A_1-114114 Glycolate oxidase subunit GLCE; oxidoreductase; 2. 98.04
1e8g_A_127-273147 Vanillyl-alcohol oxidase; oxidoreductase, flavoenz 98.0
3js8_A_88-216129 Cholesterol oxidase; cholsterol, organic solvent s 97.63
1v97_A_285-540_1311-1332278 XD, xanthine dehydrogenase; molybdopterin, FYX-051 94.03
1uxy_A_224-27249 MURB, uridine diphospho-N-acetylenolpyruvylglucosa 98.02
3i99_A_239-27638 UDP-N-acetylenolpyruvoylglucosamine reductase; oxi 92.67
>1hsk_A (A:231-304) UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus} Back     alignment and structure
Probab=99.96  E-value=2.2e-29  Score=205.63  Aligned_cols=74  Identities=39%  Similarity=0.576  Sum_probs=72.1

Q ss_pred             CCCEEEEEEEECCCCCCCHHHHHHCCCCCCCCCCEEECCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCE
Q ss_conf             66704658897278985100026318688206677871567708996899799999999999999999984754
Q gi|254781095|r  222 IKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL  295 (318)
Q Consensus       222 ~~~~s~GSvFkNP~~~~A~~LIe~~GlKG~~iG~a~vS~kHanfivN~g~ata~di~~Li~~v~~~V~~~~gi~  295 (318)
                      +++||||||||||++.+||||||+|||||+++|+|+||++|||||||.|+||++|+++||++||++|+++|||+
T Consensus         1 l~~psaGS~FkNP~~~~Ag~LIe~~GlkG~~iG~a~vS~kHanfivN~g~ata~di~~Li~~v~~~V~~~~GI~   74 (74)
T 1hsk_A            1 LEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIE   74 (74)
T ss_dssp             TTSCEECCCBCCCTTSCHHHHHHHTTCTTCEETTEEECSSCTTCEEECSSCCHHHHHHHHHHHHHHHHHHHSCC
T ss_pred             CCCCCEEECCCCCCCHHHHHHHHHHCCCCCEECCEEEECCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             77874263378876600799999848898777698996788858997899899999999999999999988982



>2gqt_A (A:199-260) UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A* Back     alignment and structure
>3i99_A (A:277-333) UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae} Back     alignment and structure
>2gqt_A (A:70-198) UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A* Back     alignment and structure
>1hsk_A (A:100-230) UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1uxy_A (A:67-190) MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli} Back     alignment and structure
>3i99_A (A:83-206) UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae} Back     alignment and structure
>2exr_A (A:116-238,A:483-524) Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structural genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A* Back     alignment and structure
>2uuu_A (A:194-315,A:549-584) Alkyldihydroxyacetonephosphate synthase; rhizomelic chondrodysplasia punctata, biosynthesis of phospholipids, flavoprotein; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Back     alignment and structure
>3i99_A (A:1-82,A:334-357) UDP-N-acetylenolpyruvoylglucosamine reductase; oxidoreductase, structural genomics, center for structural genomics of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae} Back     alignment and structure
>2gqt_A (A:1-69,A:261-268) UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A* Back     alignment and structure
>1uxy_A (A:1-66,A:320-340) MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli} Back     alignment and structure
>1hsk_A (A:1-99,A:305-326) UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1f0x_A (A:1-103) DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD; 1.90A {Escherichia coli} Back     alignment and structure
>1wvf_A (A:1-112) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit; electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} Back     alignment and structure
>2uuu_A (A:77-193) Alkyldihydroxyacetonephosphate synthase; rhizomelic chondrodysplasia punctata, biosynthesis of phospholipids, flavoprotein; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Back     alignment and structure
>1e8g_A (A:1-126) Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} Back     alignment and structure
>2exr_A (A:1-115) Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structural genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A* Back     alignment and structure
>1zr6_A (A:1-95) Glucooligosaccharide oxidase; alpha + beta, flavoenzyme, oxidoreductase; HET: NAG FAD; 1.55A {Acremonium strictum} PDB: 2axr_A* 3e0t_A* 3hsu_A* Back     alignment and structure
>3js8_A (A:1-87) Cholesterol oxidase; cholsterol, organic solvent stability, oxygen channel, FAD, flavoprotein, oxidoreductase; HET: FAD SUC; 1.54A {Chromobacterium SP} Back     alignment and structure
>2ipi_A (A:1-237,A:481-521) Aclacinomycin oxidoreductase (aknox); anthracycline, flavoenzyme, twinning, MAD; HET: AKY FAD; 1.65A {Streptomyces galilaeus} Back     alignment and structure
>1w1o_A (A:1-245,A:495-534) Cytokinin dehydrogenase 1; flavin, oxidoreductase, flavoprotein, FAD; HET: NAG FAD; 1.7A {Zea mays} Back     alignment and structure
>3fw9_A (A:1-218,A:456-495) Reticuline oxidase; BI-covalent flavinylation, N-glycosylation, alakloid biosynthesis, oxidoreductase, alkaloid metabolism; HET: FAD SLX NAG MAN; 1.49A {Eschscholzia californica} PDB: 3d2h_A* 3d2d_A* 3d2j_A* 3gsy_A* 3fw8_A* 3fw7_A* 3fwa_A* Back     alignment and structure
>2bvf_A (A:1-204,A:412-459) 6-hydroxy-D-nicotine oxidase; autoflavinylation, enantiomeric substrates, flavoenzymes, nicotine degradation; HET: FAD; 1.92A {Arthrobacter nicotinovorans} PDB: 2bvg_A* 2bvh_A* Back     alignment and structure
>1n62_C (C:1-176) Carbon monoxide dehydrogenase medium chain; CODH, copper, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans OM5} Back     alignment and structure
>2vfr_A (A:1-182) Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, flavin, flavoprotein, oxidoreductase; HET: FAD; 1.1A {Streptomyces coelicolor} PDB: 2vfs_A* 2vft_A* 2vfu_A* 2vfv_A* Back     alignment and structure
>2i0k_A (A:1-220) Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzyme; HET: FAD; 1.60A {Brevibacterium sterolicum} Back     alignment and structure
>1ffv_C (C:1-176) CUTM, flavoprotein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} Back     alignment and structure
>1t3q_C (C:1-174) Quinoline 2-oxidoreductase medium subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} Back     alignment and structure
>1rm6_B (B:1-216) 4-hydroxybenzoyl-COA reductase beta subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} Back     alignment and structure
>2w3s_A (A:168-245,A:303-344) Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1uxy_A (A:273-319) MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli} Back     alignment and structure
>1zr6_A (A:96-211,A:452-503) Glucooligosaccharide oxidase; alpha + beta, flavoenzyme, oxidoreductase; HET: NAG FAD; 1.55A {Acremonium strictum} PDB: 2axr_A* 3e0t_A* 3hsu_A* Back     alignment and structure
>1wvf_A (A:113-241) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit; electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} Back     alignment and structure
>2yvs_A (A:1-114) Glycolate oxidase subunit GLCE; oxidoreductase; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
>1e8g_A (A:127-273) Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} Back     alignment and structure