254781110

254781110

von Willebrand factor type A

GeneID in NCBI database:8210135Locus tag:CLIBASIA_05060
Protein GI in NCBI database:254781110Protein Accession:YP_003065523.1
Gene range:-(1111674, 1112936)Protein Length:420aa
Gene description:von Willebrand factor type A
COG prediction:[O] Zn-dependent protease with chaperone function
KEGG prediction:von Willebrand factor type A
SEED prediction:conserved hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MHLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRKYSVILKG
ccHHHHHHHHHHHccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHccccEEEHHHccccccccccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEHHccccEEEcccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccHHHHHHHHHHcHHHHEEccccccHHHHHHHHHHHcccHHHHHHHHHHcccccccccHHEEEEEEEccccccccccccEEEEEcHHcccEEEEEEEEEcccccHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHHHcEEEEEcc
ccHHHHHHHHEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccHEcccccEEEEEccEEEEEEEccccHHHHHHcccccccccEEEEEccccccccccHHHHHccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHccHHHcccccccEEEEEEEEEcccccccccccccccccEHHHHHccHHccccccccHHHHHHHHHHHHHcccccEEEEEcccccccccHHHEEEEEEEEcccccccccccHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc
MHLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMannrldssnntifynMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSgsmhcamnsdpedvnsapicqdkKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRvekniepswgteKVRQYVTRdmdslilkptdstpamKQAYQILTSDKKRSFFTNffrqgvkipslpfqKFIIFLtdgennnfksnVNTIKICDKAKENFIKIVTISinaspngqrLLKTcvsspeyhynvvnadSLIHVFQNISQLMVHRKYSVILKG
MHLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMannrldssnnTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTtrvekniepswgtekVRQYVTRDMdslilkptdstpamKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTisinaspngqrLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRKYSVILKG
MHLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNAlllfldsidllsHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRKYSVILKG
*******RFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSR**D**ESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHM*************YNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFI**********RPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRS*************SLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRKYSVI***
MHLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRKYSVILKG
*HLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESA*****LAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDL****************SAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRKYSVILKG
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRKYSVILKG
MHLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRKYSVILKG
MHLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRKYSVILKG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target420 von Willebrand factor type A [Candidatus Liberibacter a
254781108398 von Willebrand factor type A [Candidatus Liberibac 9e-14
254781108398 von Willebrand factor type A [Candidatus Liberibac 0.034
254780833371 hypothetical protein CLIBASIA_03630 [Candidatus Li 3e-12
254780934374 hypothetical protein CLIBASIA_04165 [Candidatus Li 1e-11
254780388458 hypothetical protein CLIBASIA_01365 [Candidatus Li 1e-09
254780388458 hypothetical protein CLIBASIA_01365 [Candidatus Li 6e-07
>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment
 Score = 69.7 bits (169), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 69/118 (58%), Gaps = 11/118 (9%)

Query: 292 TDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNN---FKSNV 348
           T++ PAM  AY+ L ++K+ S  T        I S   +KF+IF+TDGEN+    +++ +
Sbjct: 275 TNTYPAMHHAYRELYNEKESSHNT--------IGSTRLKKFVIFITDGENSGASAYQNTL 326

Query: 349 NTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNIS 406
           NT++IC+  +   +KI +++++A P GQ LL+ C  S    + V ++  L+  F  I+
Sbjct: 327 NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384

>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment
 Score = 31.2 bits (69), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 15/102 (14%)

Query: 39  FLIYVLDWH---YKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAK 95
           F+ Y +D     Y +N M+SA +AA+L+G + +VS      DR  +I +   +   D   
Sbjct: 12  FITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVS------DR--TIKDPTTKK--DQTS 61

Query: 96  RFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRL 137
              K  IK+ L   S +  N    +I   ++I++T   NN L
Sbjct: 62  TIFKKQIKKHLKQGSYIRENA--GDIAQKAQINITKDKNNPL 101

>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Back     alignment
 Score = 64.7 bits (156), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 92/189 (48%), Gaps = 15/189 (7%)

Query: 227 KMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDS 286
           K+     ++   LD I  +  V   V  GL+ +++++ +    +WG + +++ + R    
Sbjct: 191 KLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINR---- 246

Query: 287 LIL-KPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFK 345
           LI    T STP ++ AY  +   K++        + +      ++K+IIFLTDGEN++  
Sbjct: 247 LIFGSTTKSTPGLEYAYNKIFDAKEK-------LEHIAKGHDDYKKYIIFLTDGENSSPN 299

Query: 346 -SNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQN 404
             N  ++  C++AK     +  I + A    Q  LK C +SP+  Y+V N+  L   F  
Sbjct: 300 IDNKESLFYCNEAKRRGAIVYAIGVQAEAADQ-FLKNC-ASPDRFYSVQNSRKLHDAFLR 357

Query: 405 ISQLMVHRK 413
           I + MV ++
Sbjct: 358 IGKEMVKQR 366

>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Back     alignment
 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/400 (21%), Positives = 169/400 (42%), Gaps = 51/400 (12%)

Query: 19  KANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDR 78
           K   +I+ A+ +    L++G +I V    + K  + S  + +++  A+++++        
Sbjct: 16  KGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN-------- 67

Query: 79  FESISNHAKRALIDDAKRFIKNHIKESLSG--YSAVFYNTEIQNIVNSSRISMTHMANNR 136
            E   N+ K+    D    IKN    S         F N +I +IV S+ + +  +  N 
Sbjct: 68  -EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVN-DIDDIVRSTSLDIVVVPQNE 125

Query: 137 LDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELV 196
                    Y++  ++ Y   L+F   +     ++ IV  I + +++         + +V
Sbjct: 126 --------GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV 177

Query: 197 VDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGL 256
           +D+S SM                  D   TK+     ++   L+ + L+  V   V  GL
Sbjct: 178 LDVSRSMESFF--------------DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223

Query: 257 IGYTTRVEKNIEPSWGTEKVR---QYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSF 313
           + ++ ++E+     WG   ++   +Y+++   S     T+STP +K AY        + F
Sbjct: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVS-----TNSTPGLKYAYN-------QIF 271

Query: 314 FTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASP 373
                RQ        ++K I+F+TDGEN + K +  ++  C++AK+    +  I I    
Sbjct: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-I 330

Query: 374 NGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRK 413
                L+ C +SP   Y V N  S+   F +I + +V ++
Sbjct: 331 RSHEFLRAC-ASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369

>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment
 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 84/183 (45%), Gaps = 22/183 (12%)

Query: 231 LKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRD--MDSLI 288
           +++AL   + SI  + +V + V MG   +  RV  +   SWG  K+ + + +   +D   
Sbjct: 274 VRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENE 333

Query: 289 LKPTDSTPAMKQAYQILTS---DKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFK 345
           +  T    AM+ AY  + S   D+      N          L  +K+I+ LTDGEN   +
Sbjct: 334 MGSTAINDAMQTAYDTIISSNEDEVHRMKNN----------LEAKKYIVLLTDGENT--Q 381

Query: 346 SNVNTIKICDKAKENFIKIVTISINASPNGQR----LLKTCVSSPEYHYNVVNADSLIHV 401
            N   I IC+KAK   I+I+TI+ + +   Q      L  C +SP   +   +   L  +
Sbjct: 382 DNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNC-ASPNSFFEANSTHELNKI 440

Query: 402 FQN 404
           F++
Sbjct: 441 FRD 443

>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment
 Score = 47.0 bits (110), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 66/125 (52%), Gaps = 7/125 (5%)

Query: 5   SRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAG 64
           ++F FY KK I S   +F II AL +   L + G L+ V+ W Y +++++ A   AI+  
Sbjct: 5   TKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITA 64

Query: 65  ASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQNIVNS 124
           +  ++ +L  +  R ++     K+ + +   R  +N++K++       F + E+++IV  
Sbjct: 65  SVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKN-------FTDREVRDIVRD 117

Query: 125 SRISM 129
           + + M
Sbjct: 118 TAVEM 122

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target420 von Willebrand factor type A [Candidatus Liberibacter a
315122479427 von Willebrand factor type A [Candidatus Liberibacter s 1 1e-133
222087111401 hypothetical protein Arad_3867 [Agrobacterium radiobact 1 1e-16
163760496363 hypothetical protein HPDFL43_04296 [Hoeflea phototrophi 1 4e-16
241206334400 hypothetical protein Rleg_3648 [Rhizobium leguminosarum 1 2e-15
150397936419 von Willebrand factor type A [Sinorhizobium medicae WSM 1 3e-15
315122473403 von Willebrand factor type A [Candidatus Liberibacter s 1 5e-12
327189644415 hypothetical protein RHECNPAF_570041 [Rhizobium etli CN 1 8e-11
227823417413 hypothetical protein NGR_c28930 [Sinorhizobium fredii N 1 1e-10
15966595410 hypothetical protein SMc04059 [Sinorhizobium meliloti 1 1 1e-10
254781108398 von Willebrand factor type A [Candidatus Liberibacter a 1 9e-10
>gi|315122479|ref|YP_004062968.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 427 Back     alignment and organism information
 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 247/429 (57%), Positives = 322/429 (75%), Gaps = 13/429 (3%)

Query: 1   MHLLSRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAA 60
           M+LL  F F FKK I S KANFSI+F++ ++S LL IG LIYVLD+++KKN+ME+AN +A
Sbjct: 1   MNLLRTFLFNFKKIILSPKANFSILFSVILISILLFIGILIYVLDYYHKKNAMENANTSA 60

Query: 61  ILAGASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSAVFYNTEIQN 120
           IL+GASK++S +S  GD   ++S+H  RA++DD  RFIK++IKESL   S+VF  +E   
Sbjct: 61  ILSGASKIISRISYFGD---NMSSHTHRAIVDDVTRFIKSYIKESLLMDSSVFDISEKNI 117

Query: 121 IVNSSRISMT--------HMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQK 172
           I  +S++S+T        H  NN+    N   FY++ V T YDY ++F ++LLN++ N K
Sbjct: 118 ISQNSKVSITREPHPNVFHEFNNQSILQNKKTFYHISVETFYDYHIKFFDNLLNKKINSK 177

Query: 173 IVSFIPALLRIEMGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPIC-QDKKRTKMAAL 231
           I+SF+PAL++I+ GE P F ++LVVDLS SM C MNSDPE      +C + KK +KM AL
Sbjct: 178 IISFVPALVKIDTGEHPFFFVQLVVDLSASMSCLMNSDPEHATEFSVCGKSKKNSKMDAL 237

Query: 232 KNALLLFLDSIDLLSHVKEDV-YMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILK 290
           K A+LLFLDS+D  S  ++D  Y+GL GYTTRVEKNIEPSWGT KVR+Y+  ++D  +L 
Sbjct: 238 KKAVLLFLDSVDRGSKTQKDTHYIGLTGYTTRVEKNIEPSWGTGKVRKYIVEEIDVNMLG 297

Query: 291 PTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNT 350
            TDSTPAMK+AYQILTSDKKR+F  N   + +KIP LPFQKF+IFLTDGENN+ KS+V T
Sbjct: 298 QTDSTPAMKKAYQILTSDKKRNFIRNILHKRIKIPPLPFQKFLIFLTDGENNDPKSDVKT 357

Query: 351 IKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMV 410
           IKIC+KAK+N IKI+TISINAS NG+RLLK CVS+PEY+YNVV+  SL+ VFQ+IS L+ 
Sbjct: 358 IKICEKAKKNSIKILTISINASANGKRLLKKCVSAPEYYYNVVDTGSLLRVFQDISTLIT 417

Query: 411 HRKYSVILK 419
           H KY VILK
Sbjct: 418 HYKYQVILK 426


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087111|ref|YP_002545646.1| hypothetical protein Arad_3867 [Agrobacterium radiobacter K84] Length = 401 Back     alignment and organism information
>gi|163760496|ref|ZP_02167578.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43] Length = 363 Back     alignment and organism information
>gi|241206334|ref|YP_002977430.1| hypothetical protein Rleg_3648 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 400 Back     alignment and organism information
>gi|150397936|ref|YP_001328403.1| von Willebrand factor type A [Sinorhizobium medicae WSM419] Length = 419 Back     alignment and organism information
>gi|315122473|ref|YP_004062962.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 403 Back     alignment and organism information
>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512] Length = 415 Back     alignment and organism information
>gi|227823417|ref|YP_002827390.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234] Length = 413 Back     alignment and organism information
>gi|15966595|ref|NP_386948.1| hypothetical protein SMc04059 [Sinorhizobium meliloti 1021] Length = 410 Back     alignment and organism information
>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target420 von Willebrand factor type A [Candidatus Liberibacter a
smart00327177 smart00327, VWA, von Willebrand factor (vWF) type A dom 1e-05
COG1240261 COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme meta 0.002
cd00198161 cd00198, vWFA, Von Willebrand factor type A (vWA) domai 2e-04
>gnl|CDD|128622 smart00327, VWA, von Willebrand factor (vWF) type A domain Back     alignment and domain information
>gnl|CDD|31433 COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|29222 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 420 von Willebrand factor type A [Candidatus Liberibacter a
PRK13685326 hypothetical protein; Provisional 99.88
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a major 97.42
KOG2884259 consensus 95.45
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor type 99.85
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor type A 99.82
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin 99.75
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor ty 99.7
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extr 99.67
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) typ 99.66
cd01470198 vWA_complement_factors Complement factors B and C2 are 99.63
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is 99.63
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type 99.6
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelata 99.57
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel like: V 99.55
pfam00092177 VWA von Willebrand factor type A domain. 99.55
cd01469177 vWA_integrins_alpha_subunit Integrins are a class of ad 99.54
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhe 99.51
cd01472164 vWA_collagen von Willebrand factor (vWF) type A domain; 99.51
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor type 99.5
cd01471186 vWA_micronemal_protein Micronemal proteins: The Toxopla 99.49
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) d 99.48
TIGR00868 874 hCaCC calcium-activated chloride channel protein 1; Int 99.47
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA doma 99.44
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) li 99.43
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extracellula 99.39
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was orig 99.39
TIGR03436296 acidobact_VWFA VWFA-related Acidobacterial domain. Memb 99.34
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebrates) 99.34
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type 99.18
COG1240261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] 99.02
cd01454174 vWA_norD_type norD type: Denitrifying bacteria contain 98.95
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand facto 98.95
COG4245207 TerY Uncharacterized protein encoded in toxicity protec 98.77
cd01453183 vWA_transcription_factor_IIH_type Transcription factors 98.4
PRK13406584 bchD magnesium chelatase subunit D; Provisional 98.36
TIGR02442688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 98.32
TIGR02031705 BchD-ChlD magnesium chelatase ATPase subunit D; InterPr 98.05
KOG2353 1104 consensus 97.97
cd01457199 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor 97.81
pfam04056250 Ssl1 Ssl1-like. Ssl1-like proteins are 40kDa subunits o 97.41
COG2425437 Uncharacterized protein containing a von Willebrand fac 97.34
KOG2807 378 consensus 96.75
COG2304 399 Uncharacterized protein containing a von Willebrand fac 96.75
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) do 96.22
COG4961185 TadG Flp pilus assembly protein TadG [Intracellular tra 99.48
COG4655 565 Predicted membrane protein [Function unknown] 97.54
pfam0781143 TadE TadE-like protein. The members of this family are 96.54
COG4548637 NorD Nitric oxide reductase activation protein [Inorgan 97.56
pfam11775220 CobT_C Cobalamin biosynthesis protein CobT VWA domain. 97.34
COG4867652 Uncharacterized protein with a von Willebrand factor ty 90.23
pfam05762223 VWA_CoxE VWA domain containing CoxE-like protein. This 92.83
COG4547620 CobT Cobalamin biosynthesis protein CobT (nicotinate-mo 90.78
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>KOG2884 consensus Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>pfam00092 VWA von Willebrand factor type A domain Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1; InterPro: IPR004727 This entry represents a family of Ca(2+)-regulated chloride channels (CLCA) which includes bovine, murine and human proteins , Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR012804 Cobalamin (vitamin B12) can be complexed with metal via ATP-dependent reactions (aerobic pathway) (e Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D; InterPro: IPR011776 This entry represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX Back     alignment and domain information
>KOG2353 consensus Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>pfam04056 Ssl1 Ssl1-like Back     alignment and domain information
>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG2807 consensus Back     alignment and domain information
>COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4655 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam07811 TadE TadE-like protein Back     alignment and domain information
>COG4548 NorD Nitric oxide reductase activation protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam11775 CobT_C Cobalamin biosynthesis protein CobT VWA domain Back     alignment and domain information
>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>pfam05762 VWA_CoxE VWA domain containing CoxE-like protein Back     alignment and domain information
>COG4547 CobT Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target420 von Willebrand factor type A [Candidatus Liberibacter a
3n2n_F185 The Crystal Structure Of Tumor Endothelial Marker 8 4e-07
1tzn_a181 Crystal Structure Of The Anthrax Toxin Protective A 3e-06
1shu_X182 Crystal Structure Of The Von Willebrand Factor A Do 3e-06
1sht_X181 Crystal Structure Of The Von Willebrand Factor A Do 3e-06
1ck4_A198 Crystal Structure Of Rat A1b1 Integrin I-Domain. Le 1e-05
2b2x_A223 Vla1 Rdeltah I-Domain Complexed With A Quadruple Mu 2e-05
1t6b_Y189 Crystal Structure Of B. Anthracis Protective Antige 3e-05
1mhp_A192 Crystal Structure Of A Chimeric Alpha1 Integrin I-D 3e-05
3k6s_A 1095 Structure Of Integrin Alphaxbeta2 Ectodomain Length 0.002
>gi|316983245|pdb|3N2N|F Chain F, The Crystal Structure Of Tumor Endothelial Marker 8 (Tem8) Extracellular Domain Length = 185 Back     alignment and structure
 Score = 61.0 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/177 (13%), Positives = 64/177 (36%), Gaps = 19/177 (10%)

Query: 233 NALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPT 292
           N +  F++ +     +   + M  I ++TR    ++ +   E++RQ +      L    T
Sbjct: 25  NEIYYFVEQLAHK-FISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDT 83

Query: 293 DSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIK 352
                 ++A + +  + +                      II LTDGE +       + +
Sbjct: 84  YMHEGFERASEQIYYENR--------------QGYRTASVIIALTDGELHEDLFF-YSER 128

Query: 353 ICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVN-ADSLIHVFQNISQL 408
             +++++    +  + +      +  L     S ++ + V +   +L  +  +I + 
Sbjct: 129 EANRSRDLGAIVYAVGVKD--FNETQLARIADSKDHVFPVNDGFQALQGIIHSILKK 183


>gi|52695907|pdb|1TZN|AA Chain a, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor Length = 181 Back     alignment and structure
>gi|48425689|pdb|1SHU|X Chain X, Crystal Structure Of The Von Willebrand Factor A Domain Of Human Capillary Morphogenesis Protein 2: An Anthrax Toxin Receptor Length = 182 Back     alignment and structure
>gi|48425688|pdb|1SHT|X Chain X, Crystal Structure Of The Von Willebrand Factor A Domain Of Human Capillary Morphogenesis Protein 2: An Anthrax Toxin Receptor Length = 181 Back     alignment and structure
>gi|7766811|pdb|1CK4|A Chain A, Crystal Structure Of Rat A1b1 Integrin I-Domain. Length = 198 Back     alignment and structure
>gi|99031847|pdb|2B2X|A Chain A, Vla1 Rdeltah I-Domain Complexed With A Quadruple Mutant Of The Aqc2 Fab Length = 223 Back     alignment and structure
>gi|51247575|pdb|1T6B|Y Chain Y, Crystal Structure Of B. Anthracis Protective Antigen Complexed With Human Anthrax Toxin Receptor Length = 189 Back     alignment and structure
>gi|30749469|pdb|1MHP|A Chain A, Crystal Structure Of A Chimeric Alpha1 Integrin I-Domain In Complex With The Fab Fragment Of A Humanized Neutralizing Antibody Length = 192 Back     alignment and structure
>gi|283807143|pdb|3K6S|A Chain A, Structure Of Integrin Alphaxbeta2 Ectodomain Length = 1095 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target420 von Willebrand factor type A [Candidatus Liberibacter a
2odp_A 509 Complement C2; C3/C5 convertase, complement serine prot 6e-10
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sapiens 5e-08
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, I do 6e-07
3hrz_D 741 Complement factor B; serine protease, glycosilated, mul 7e-07
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, blood 2e-06
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell adhesi 8e-06
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} S 4e-05
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacteriochl 2e-04
>2odp_A Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
 Score = 60.7 bits (146), Expect = 6e-10
 Identities = 30/229 (13%), Positives = 72/229 (31%), Gaps = 42/229 (18%)

Query: 193 IELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDV 252
           + L++D S S+                            K +  L +D I      + +V
Sbjct: 12  LYLLLDASQSV--------------------SENDFLIFKESASLMVDRIFSF---EINV 48

Query: 253 YMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKP------TDSTPAMKQAYQILT 306
            + +I + +  +  +       +    V   +++   K       T++  A+   Y ++ 
Sbjct: 49  SVAIITFASEPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMN 108

Query: 307 SDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIK------ICDKAKEN 360
           +  +         Q +       +  II LTDG++N   S    +         ++ + +
Sbjct: 109 NQMRLLGMETMAWQEI-------RHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRND 161

Query: 361 FIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLM 409
           ++ I  I +       R L    S  +   +         + Q    ++
Sbjct: 162 YLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHML 210


>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Length = 223 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Length = 741 Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Length = 202 Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Length = 198 Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 1n9z_A 1bhq_1 1bho_1 1idn_1 Length = 194 Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Length = 189 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target420 von Willebrand factor type A [Candidatus Liberibacter a
2odp_A 509 Complement C2; C3/C5 convertase, complement serine prot 99.72
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold, mem 99.71
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, I do 99.7
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sapiens 99.67
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, antagonis 99.64
3ibs_A218 Conserved hypothetical protein BATB; structural genomic 99.6
1pt6_A213 Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.8 99.59
2b2x_A223 Integrin alpha-1; computational design, antibody-antige 99.55
1atz_A189 VON willebrand factor; collagen-binding, hemostasis, di 99.52
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell adhesi 99.51
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} S 99.49
3gxb_A184 VON willebrand factor; VWA-like fold, blood coagulation 99.48
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, blood 99.46
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1.30A { 99.12
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacteriochl 98.96
2iue_A212 Pactolus I-domain; membrane protein, CD, ITC, limbs, mi 98.73
3hrz_D 741 Complement factor B; serine protease, glycosilated, mul 99.58
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule, cel 98.86
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; nucle 99.41
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hydrola 99.16
1jey_B 565 KU80; double-strand DNA break repair, non-homologous EN 97.93
2nvo_A535 RO sixty-related protein, RSR; alpha helical repeats, V 97.78
2vdr_B461 Integrin beta-3; cell adhesion/immune system, alternati 97.72
1yvr_A538 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kD 97.62
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EGF dom 97.46
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, cell 95.96
>2odp_A Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
Probab=99.72  E-value=2.5e-16  Score=123.38  Aligned_cols=194  Identities=16%  Similarity=0.207  Sum_probs=133.2

Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCC
Q ss_conf             34434432012210223242233578766667534676653067889998999985104678765543022320487643
Q gi|254781110|r  185 MGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVE  264 (420)
Q Consensus       185 ~~~~~~~~~~~~~d~s~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  264 (420)
                      +......|+.|++|.|+||.                    ..+++.+++.+..+++.+...   ....|++++.|++...
T Consensus         4 ~~~~g~~DivfvlD~SgSm~--------------------~~~~~~~k~~~~~~i~~~~~~---~~~~rv~lv~fs~~~~   60 (509)
T 2odp_A            4 IQRSGHLNLYLLLDASQSVS--------------------ENDFLIFKESASLMVDRIFSF---EINVSVAIITFASEPK   60 (509)
T ss_dssp             CCSSSEEEEEEEEECSTTSC--------------------HHHHHHHHHHHHHHHHHHHTT---CCCEEEEEEEESSSEE
T ss_pred             CCCCCCEEEEEEEECCCCCC--------------------HHHHHHHHHHHHHHHHHHCCC---CCCCEEEEEEECCEEE
T ss_conf             56789865999997869999--------------------899999999999999961448---9974899999888357


Q ss_pred             CCCCCCCCH----HHHHHHHHHHH--HCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEC
Q ss_conf             124457784----88999999864--046788765388999999861310123345543347767787766624899606
Q gi|254781110|r  265 KNIEPSWGT----EKVRQYVTRDM--DSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTD  338 (420)
Q Consensus       265 ~~~~lt~~~----~~~~~~i~~~~--~~~~~g~T~~~~gl~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~k~iil~TD  338 (420)
                      ...+|+...    ..+.+.+..+.  ....+|+|++..||..++..+........       ......++.+|++||+||
T Consensus        61 ~~~~l~~~~~~~~~~~~~~i~~i~~~~~~~~g~T~~~~Al~~a~~~~~~~~~~~~-------~~~~~~~~~~~~iillTD  133 (509)
T 2odp_A           61 VLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLG-------METMAWQEIRHAIILLTD  133 (509)
T ss_dssp             EEECTTSGGGGCHHHHHHHHHTCCGGGGTTCCSCCHHHHHHHHHHHHHHHHHHHC-------TTSHHHHTEEEEEEEESC
T ss_pred             EEEECCCCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC-------CCCCCCCCCCEEEEEECC
T ss_conf             9971788875579999999971734567789977799999999999998764302-------355666788629999948


Q ss_pred             CCCCCCCCCCHHH-HHHH-----HHHHCCCEEEEEEECCCCCHHHHHHHHHCCC---CCEEEECCHHHHHHHHHHHHHH
Q ss_conf             8677777653489-9999-----9997898799999548977899999862189---8279817989999999999987
Q gi|254781110|r  339 GENNNFKSNVNTI-KICD-----KAKENFIKIVTISINASPNGQRLLKTCVSSP---EYHYNVVNADSLIHVFQNISQL  408 (420)
Q Consensus       339 G~~~~~~~~~~~~-~~c~-----~~k~~gi~i~tIgf~~~~~~~~~l~~cas~~---~~yf~a~~~~~L~~aF~~Ia~~  408 (420)
                      |..|.+....... .+.+     ..|+.||.||+||+|...-..+.|+..|+.+   .|+|.+++.++|.++|++|-.+
T Consensus       134 G~~n~g~~~~~~~~~~~~~~~~~~~~~~~v~i~~igvG~~~~d~~~L~~ias~~~~~~h~f~~~~~~~L~~~~~~i~~~  212 (509)
T 2odp_A          134 GKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHMLDV  212 (509)
T ss_dssp             SCCCSSSCTHHHHHHHHHHTTCCSTTGGGEEEEEEEESSSCCCHHHHHHHSCCCTTCCCEEEESSHHHHHHHHHHHEEC
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHCCCC
T ss_conf             8756699848999998766666566306965999995886458999999865999971599948888999999740442



>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhesion, glycoprotein, toxin/cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for structural genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1pt6_A Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune system; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 1n9z_A 1bhq_1 1bho_1 1idn_1 Back     alignment and structure
>3gxb_A VON willebrand factor; VWA-like fold, blood coagulation, cell adhesion, cleavage on PAIR of basic residues, disease mutation, disulfide bond; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- sheet, RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure
>2vdr_B Integrin beta-3; cell adhesion/immune system, alternative splicing, platelet integrin ALPHAIIBBETA3, polymorphism, glycoprotein, cell adhesion, calcium; HET: NAG MAN; 2.40A {Homo sapiens} PDB: 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, alternative splicing, cell adhesion, disease mutation, glycoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 420 von Willebrand factor type A [Candidatus Liberibacter a
d1jeya2220 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Hum 1e-04
d1q0pa_209 c.62.1.1 (A:) Complement factor B domain {Human (Homo s 0.001
d1jeyb2236 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Huma 2e-04
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 220 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Ku70 subunit N-terminal domain
domain: Ku70 subunit N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.9 bits (97), Expect = 1e-04
 Identities = 22/231 (9%), Positives = 64/231 (27%), Gaps = 30/231 (12%)

Query: 195 LVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYM 254
            +VD S +M     S  ED          + T        +     S  + S   +   +
Sbjct: 7   FLVDASKAMF---ESQSED----------ELTPFDMSIQCIQSVYISKIISS---DRDLL 50

Query: 255 GLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSFF 314
            ++ Y T  +KN         +++        ++          ++ +Q +         
Sbjct: 51  AVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSL 110

Query: 315 TNFFRQGVKI----PSLPFQKFIIFLTDGENNNFKSNVNT---IKICDKAKENFIKIVTI 367
           +        +          K I+  T+ +N +   +             ++  I +  +
Sbjct: 111 SEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLM 170

Query: 368 SI------NASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHR 412
            +      + S   + ++       +   +   +  L  + + +      +
Sbjct: 171 HLKKPGGFDISLFYRDIISI-AEDEDLRVHFEESSKLEDLLRKVRAKETRK 220


>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target420 von Willebrand factor type A [Candidatus Liberibacter a
d1shux_181 Capillary morphogenesis protein 2 domain {Human (Homo s 99.71
d1q0pa_209 Complement factor B domain {Human (Homo sapiens) [TaxId 99.69
d1pt6a_192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 960 99.61
d1v7pc_193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 960 99.58
d1n3ya_189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 96 99.58
d1atza_184 von Willebrand factor A3 domain, vWA3 {Human (Homo sapi 99.56
d1ijba_202 von Willebrand factor A1 domain, vWA1 {Human (Homo sapi 99.55
d1mf7a_194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) 99.51
d1mjna_179 Integrin CD11a/CD18 (Leukocyte function associated anti 99.32
d1jeya2220 Ku70 subunit N-terminal domain {Human (Homo sapiens) [T 99.08
d1tyeb2248 Integrin beta A domain {Human (Homo sapiens) [TaxId: 96 98.31
d1jeyb2236 Ku80 subunit N-terminal domain {Human (Homo sapiens) [T 99.03
d1yvra2174 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed 98.23
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Integrin A (or I) domain
domain: Capillary morphogenesis protein 2 domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71  E-value=9.4e-16  Score=118.11  Aligned_cols=175  Identities=15%  Similarity=0.129  Sum_probs=137.2

Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCC
Q ss_conf             43201221022324223357876666753467665306788999899998510467876554302232048764312445
Q gi|254781110|r  190 IFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEP  269 (420)
Q Consensus       190 ~~~~~~~~d~s~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  269 (420)
                      ..|+.|++|.|+||..                     .+...++.+..++..+.     ....|++++.|++......++
T Consensus         5 ~~Div~llD~S~Sm~~---------------------~~~~~k~~~~~~~~~~~-----~~~~rvglv~fs~~~~~~~~l   58 (181)
T d1shux_           5 AFDLYFVLDKSGSVAN---------------------NWIEIYNFVQQLAERFV-----SPEMRLSFIVFSSQATIILPL   58 (181)
T ss_dssp             CEEEEEEEECSGGGGG---------------------GHHHHHHHHHHHHHHCC-----CTTEEEEEEEESSSEEEEEEE
T ss_pred             CEEEEEEEECCCCCCC---------------------CHHHHHHHHHHHHHHHC-----CCCCEEEEEEEECCEEEEEEE
T ss_conf             6589999947888533---------------------79999999999999726-----899789999960423799972


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCH
Q ss_conf             77848899999986404678876538899999986131012334554334776778776662489960686777776534
Q gi|254781110|r  270 SWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVN  349 (420)
Q Consensus       270 t~~~~~~~~~i~~~~~~~~~g~T~~~~gl~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~k~iil~TDG~~~~~~~~~~  349 (420)
                      +.+.......+..+....+.|+|+.+.||.++.+.+....                ..+.+|++|++|||..+... ...
T Consensus        59 ~~~~~~~~~~l~~l~~~~~~g~t~~~~al~~~~~~~~~~~----------------~~~~~~~ivliTDG~~~~~~-~~~  121 (181)
T d1shux_          59 TGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAG----------------GLKTSSIIIALTDGKLDGLV-PSY  121 (181)
T ss_dssp             ECCHHHHHHHHHHHHTCCCCSCCCHHHHHHHHHHHHHHHT----------------GGGSCEEEEEEECCCCCTTH-HHH
T ss_pred             CCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCC----------------CCCCCEEEEEECCCCCCCCC-CHH
T ss_conf             4888999997653222367785068999999998763003----------------57875289992478778886-389


Q ss_pred             HHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCCCEEEECC-HHHHHHHHHHHHHHH
Q ss_conf             899999999789879999954897789999986218982798179-899999999999874
Q gi|254781110|r  350 TIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVN-ADSLIHVFQNISQLM  409 (420)
Q Consensus       350 ~~~~c~~~k~~gi~i~tIgf~~~~~~~~~l~~cas~~~~yf~a~~-~~~L~~aF~~Ia~~I  409 (420)
                      ....++.+|+.||.||+||+|. .+ ...|+..|++|+++|.+.+ .++|.+.++.|.+.|
T Consensus       122 ~~~~~~~~k~~gv~v~~vgig~-~~-~~~L~~ia~~~~~~~~~~~~~~~L~~~~~~i~~~i  180 (181)
T d1shux_         122 AEKEAKISRSLGASVYCVGVLD-FE-QAQLERIADSKEQVFPVKGGFQALKGIINSILAQS  180 (181)
T ss_dssp             HHHHHHHHHHTTCEEEEEECSS-CC-HHHHHHHSSSGGGEEESSSTTHHHHHHHHHHHHTB
T ss_pred             HHHHHHHHHHCCCEEEEEEECC-CC-HHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHH
T ss_conf             9999999997898899999685-48-99999984899965994599999999999998633



>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 420 von Willebrand factor type A [Candidatus Liberibac
2odp_A_1-224224 (A:1-224) Complement C2; C3/C5 convertase, complem 8e-10
2ww8_A_221-279_318-447_506-585269 (A:221-279,A:318-447,A:506-585) RRGA, cell WALL su 2e-08
3hrz_D_199-457259 (D:199-457) Complement factor B; serine protease, 3e-08
1jey_A_1-252252 (A:1-252) KU70; double-strand DNA break repair, no 1e-07
1ijb_A_202 (A:) VON willebrand factor; dinucleotide-binding f 2e-07
1q0p_A_223 (A:) Complement factor B; VON willebrand factor, M 4e-07
1jey_B_1-236_463-505279 (B:1-236,B:463-505) KU80; double-strand DNA break 3e-06
1mjn_A_179 (A:) Integrin alpha-L; rossmann fold, immune syste 4e-06
3k6s_A_125-315191 (A:125-315) Integrin alpha-X; hetero dimer, cell r 1e-05
2b2x_A_223 (A:) Integrin alpha-1; computational design, antib 2e-05
1mf7_A_194 (A:) Integrin alpha M; cell adhesion; 1.25A {Homo 6e-05
1v7p_C_200 (C:) Integrin alpha-2; snake venom, C-type lectin, 8e-05
1rrk_A_1-214214 (A:1-214) Complement factor B; BB, hydrolase; 2.00 9e-05
1pt6_A_213 (A:) Integrin alpha-1; X-RAY diffraction, cell adh 1e-04
1atz_A_189 (A:) VON willebrand factor; collagen-binding, hemo 4e-04
1n3y_A_198 (A:) Integrin alpha-X; alpha/beta rossmann fold, c 6e-04
2nvo_A_53-64_359-535189 (A:53-64,A:359-535) RO sixty-related protein, RSR; 1e-04
1yvr_A_365-538174 (A:365-538) RO autoantigen, 60-kDa SS-A/RO ribonuc 1e-04
>2odp_A (A:1-224) Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A*Length = 224 Back     alignment and structure
 Score = 59.2 bits (142), Expect = 8e-10
 Identities = 34/241 (14%), Positives = 81/241 (33%), Gaps = 45/241 (18%)

Query: 182 RIEMGERPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDS 241
           +I++       + L++D S S+                            K +  L +D 
Sbjct: 1   KIQIQRSGHLNLYLLLDASQSV--------------------SENDFLIFKESASLMVDR 40

Query: 242 IDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILK------PTDST 295
           I      + +V + +I + +  +  +       +    V   +++   K       T++ 
Sbjct: 41  IFSF---EINVSVAIITFASEPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTY 97

Query: 296 PAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENN------NFKSNVN 349
            A+   Y ++ +  +         Q ++         II LTDG++N          ++ 
Sbjct: 98  AALNSVYLMMNNQMRLLGMETMAWQEIR-------HAIILLTDGKSNMGGSPKTAVDHIR 150

Query: 350 TIKICDKAKENFIKIVTISINASPNGQRLLK--TCVSSPEYHY-NVVNADSLIHVFQNIS 406
            I   ++ + +++ I  I +       R L         E H   + +  +L  VF+++ 
Sbjct: 151 EILNINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHML 210

Query: 407 Q 407
            
Sbjct: 211 D 211


>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}Length = 269 Back     alignment and structure
>3hrz_D (D:199-457) Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A*Length = 259 Back     alignment and structure
>1jey_A (A:1-252) KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens}Length = 252 Back     alignment and structure
>1ijb_A (A:) VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens}Length = 202 Back     alignment and structure
>1q0p_A (A:) Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens}Length = 223 Back     alignment and structure
>1jey_B (B:1-236,B:463-505) KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens}Length = 279 Back     alignment and structure
>1mjn_A (A:) Integrin alpha-L; rossmann fold, immune system; 1.30A {Escherichia coli}Length = 179 Back     alignment and structure
>3k6s_A (A:125-315) Integrin alpha-X; hetero dimer, cell receptor, adhesion molecule, calcium, cell adhesion, disulfide bond, glycoprotein, magnesium, membrane; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A*Length = 191 Back     alignment and structure
>2b2x_A (A:) Integrin alpha-1; computational design, antibody-antigen complex, immune system; 2.20A {Rattus norvegicus}Length = 223 Back     alignment and structure
>1mf7_A (A:) Integrin alpha M; cell adhesion; 1.25A {Homo sapiens}Length = 194 Back     alignment and structure
>1v7p_C (C:) Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhesion, glycoprotein, toxin/cell adhesion complex; HET: NAG; 1.90A {Homo sapiens}Length = 200 Back     alignment and structure
>1rrk_A (A:1-214) Complement factor B; BB, hydrolase; 2.00A {Homo sapiens}Length = 214 Back     alignment and structure
>1pt6_A (A:) Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.87A {Homo sapiens}Length = 213 Back     alignment and structure
>1atz_A (A:) VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens}Length = 189 Back     alignment and structure
>1n3y_A (A:) Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens}Length = 198 Back     alignment and structure
>2nvo_A (A:53-64,A:359-535) RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- sheet, RNA binding protein; 1.89A {Deinococcus radiodurans}Length = 189 Back     alignment and structure
>1yvr_A (A:365-538) RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis}Length = 174 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target420 von Willebrand factor type A [Candidatus Liberibacter a
2ww8_A_221-279_318-447_506-585269 RRGA, cell WALL surface anchor family protein; IGG 99.93
3hrz_D_199-457259 Complement factor B; serine protease, glycosilated 99.69
1rrk_A_1-214214 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.67
2odp_A_1-224224 Complement C2; C3/C5 convertase, complement serine 99.63
1shu_X_182 Anthrax toxin receptor 2; alpha/beta rossmann fold 99.62
1q0p_A_223 Complement factor B; VON willebrand factor, MAC-1, 99.57
3gxb_A_184 VON willebrand factor; VWA-like fold, blood coagul 99.56
3ibs_A_218 Conserved hypothetical protein BATB; structural ge 99.56
1atz_A_189 VON willebrand factor; collagen-binding, hemostasi 99.54
1ijb_A_202 VON willebrand factor; dinucleotide-binding fold, 99.54
1jey_A_1-252252 KU70; double-strand DNA break repair, non-homologo 99.46
1n3y_A_198 Integrin alpha-X; alpha/beta rossmann fold, cell a 99.45
2b2x_A_223 Integrin alpha-1; computational design, antibody-a 99.44
1v7p_C_200 Integrin alpha-2; snake venom, C-type lectin, anta 99.41
1jey_B_1-236_463-505279 KU80; double-strand DNA break repair, non-homologo 99.4
1mf7_A_194 Integrin alpha M; cell adhesion; 1.25A {Homo sapie 99.39
3k6s_A_125-315191 Integrin alpha-X; hetero dimer, cell receptor, adh 99.38
1pt6_A_213 Integrin alpha-1; X-RAY diffraction, cell adhesion 99.35
1mjn_A_179 Integrin alpha-L; rossmann fold, immune system; 1. 99.31
2vdr_B_110-351242 Integrin beta-3; cell adhesion/immune system, alte 99.02
2iue_A_212 Pactolus I-domain; membrane protein, CD, ITC, limb 98.78
1yvr_A_365-538174 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 99.13
2nvo_A_53-64_359-535189 RO sixty-related protein, RSR; alpha helical repea 98.99
3fcs_B_109-352244 Integrin beta-3; beta propeller, rossmann fold, EG 98.53
3k6s_B_102-342241 Integrin beta-2; hetero dimer, cell receptor, adhe 98.41
3eh1_A_155-399245 Protein transport protein SEC24B; copii coat prote 92.08
3lft_A_118-235118 Uncharacterized protein; ABC, ATPase, cassette, L- 90.75
>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
Probab=99.93  E-value=7.5e-25  Score=179.89  Aligned_cols=186  Identities=16%  Similarity=0.153  Sum_probs=141.1

Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCC
Q ss_conf             44320122102232422335787666675346766530678899989999851046787655430223204876431244
Q gi|254781110|r  189 PIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIE  268 (420)
Q Consensus       189 ~~~~~~~~~d~s~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  268 (420)
                      ...++.+++|.|+||......              ..+|++.++.+...+++.+...+    ..+++++.|++.......
T Consensus         3 ~~~~i~~viD~S~SM~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~----~~~v~lv~f~~~~~~~~~   64 (269)
T 2ww8_A            3 VPLDVVILLDNSNSMSNIRNK--------------NARRAERAGEATRSLIDKITSDS----ENRVALVTYASTIDYSYL   64 (269)
T ss_dssp             CCEEEEEEEECCGGGCTTHHH--------------HCCHHHHHHHHHHHHHHHHHTST----TCEEEEEEESSSBBCCEE
T ss_pred             CCCCEEEEECCCCCCCCCCCC--------------CCEEEEECCCCEEEEEEEEEECC----CCEEEEEEECCCCCCCEE
T ss_conf             245579996146630001346--------------53056522645046425777537----860578840231042025


Q ss_pred             CCCCHHHHHHHHH-----------HHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             5778488999999-----------86404678876538899999986131012334554334776778776662489960
Q gi|254781110|r  269 PSWGTEKVRQYVT-----------RDMDSLILKPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLT  337 (420)
Q Consensus       269 lt~~~~~~~~~i~-----------~~~~~~~~g~T~~~~gl~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~k~iil~T  337 (420)
                      ...........+.           .+....++|+|+++.||.|+++.+.+.+                ....+|++||||
T Consensus        65 ~~~~~~~~~~~l~~~~~~~~~l~~~i~~~~~~GgT~~~~AL~~a~~~l~~~~----------------~~~~~kvIiliT  128 (269)
T 2ww8_A           65 KLTNDKNDIVELKNKVPTEAEDHDGNRLMYQFGATFTQKALMKADEILTQQA----------------RQNSQKVIFHIT  128 (269)
T ss_dssp             EEECCHHHHHHHHHHSCSCCCCSCTTSGGGGGCSCCHHHHHHHHHHHHHHHS----------------CSSSEEEEEEEE
T ss_pred             EEEECCCCEEEECCEEEEEECCCCCCCEEECCCCEEEEEECCCCCEEEEECC----------------CCCCCEEEEECC
T ss_conf             5541254113303101232102456410101462466530022414776215----------------776520478615


Q ss_pred             CCCCCCCCC---------------------------------------------------------------CCHHHHHH
Q ss_conf             686777776---------------------------------------------------------------53489999
Q gi|254781110|r  338 DGENNNFKS---------------------------------------------------------------NVNTIKIC  354 (420)
Q Consensus       338 DG~~~~~~~---------------------------------------------------------------~~~~~~~c  354 (420)
                      ||.++....                                                               +..+..+|
T Consensus       129 DG~~~~~~~~~~~~~~~~~~~~v~i~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c  208 (269)
T 2ww8_A          129 DGVPTMSYPINFNHATFAPSYQNQLNAFFSKSPNKDGILLSDFITQATSGEHTIVRGDGQSNSNTAKITNHGDPTRWYYN  208 (269)
T ss_dssp             SSCCSEECCBCCCCSTTCCCHHHHHHHHHHTSTTSSSCCGGGBCCCCTTCGGGTCEECSSCTCSSCCBCBSHHHHHHHHH
T ss_pred             CCCCCEEECCCCCCCCCCEEEECCCEEEEEECCCCCEEEECCEEEEECCCCCEEECCCCEECCCCEEEEECCCCEEEEEE
T ss_conf             66310000013445410047631310566511211206611101231012210203774275320576204743057887


Q ss_pred             HHHHHCCCEEEEEEECCCCC-------HHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHC
Q ss_conf             99997898799999548977-------8999998621898279817989999999999987420
Q gi|254781110|r  355 DKAKENFIKIVTISINASPN-------GQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVH  411 (420)
Q Consensus       355 ~~~k~~gi~i~tIgf~~~~~-------~~~~l~~cas~~~~yf~a~~~~~L~~aF~~Ia~~I~~  411 (420)
                      +++|++||+||||||+.+.+       ++++|+.|||+|+|||+|+   ||.++|+.|+++|-+
T Consensus       209 ~~~k~~~i~i~ti~~~~~~~~~~~~~~~~~~l~~cas~~~~y~~~~---~~~~~f~~ia~~~~~  269 (269)
T 2ww8_A          209 GNIAPDGYDVFTVGIGINGDPGTDEATATSFMQSISSKPENYTNVT---DTTKILEQLNRYFHT  269 (269)
T ss_dssp             HHTGGGCCEEEEEEESCCCTTTSCHHHHHHHHHHTSSSGGGEEEES---SGGGHHHHHHHHHTT
T ss_pred             EECCCCCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCEEEEC---CCCCEECCCCCCCEE
T ss_conf             5204676303577677156421002343057756611665326405---665111133554127



>3hrz_D (D:199-457) Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Back     alignment and structure
>1rrk_A (A:1-214) Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} Back     alignment and structure