254781109

254781109

hypothetical protein CLIBASIA_05055

GeneID in NCBI database:8210134Locus tag:CLIBASIA_05055
Protein GI in NCBI database:254781109Protein Accession:YP_003065522.1
Gene range:-(1111050, 1111310)Protein Length:86aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80------
MILKNSTKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSHRRFFALLFIYLIIIFRFMLLIVKAVF
ccccccccHHEEccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHc
cccccccHHHHccccEEEEEEHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHc
MILKNSTKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSHRRFFALLFIYLIIIFRFMLLIVKAVF
milknstklllrGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSHRRFFALLFIYLIIIFRFMLLIVKAVF
MILKNSTKLLLRGRNivifisfidsiiLWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSHrrffallfiyliiifrfmlliVKAVF
*****STKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSHRRFFALLFIYLIIIFRFMLLIVKAVF
MILKNSTKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSHRRFFALLFIYLIIIFRFMLLIVKAVF
*ILKNSTKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSHRRFFALLFIYLIIIFRFMLLIVKAVF
iiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
xxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxx
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILKNSTKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSHRRFFALLFIYLIIIFRFMLLIVKAVF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target86 hypothetical protein CLIBASIA_05055 [Candidatus Liberib
31512247886 hypothetical protein CKC_03650 [Candidatus Liberibacter 1 2e-22
>gi|315122478|ref|YP_004062967.1| hypothetical protein CKC_03650 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 86 Back     alignment and organism information
 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%)

Query: 1  MILKNSTKLLLRGRNIVIFISFIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLCRPVSH 60
          M LKN  KLLLRGRNI+I ISF+DSIILW +H+ HVDFVIDSLMNL+L++LI++C P+S+
Sbjct: 1  MFLKNCNKLLLRGRNIIIVISFLDSIILWYKHNNHVDFVIDSLMNLSLVLLIIICNPISN 60

Query: 61 RRFFALLFIY 70
          RRFFALLFIY
Sbjct: 61 RRFFALLFIY 70


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00