254781111

254781111

geranyltranstransferase protein

GeneID in NCBI database:8210136Locus tag:CLIBASIA_05065
Protein GI in NCBI database:254781111Protein Accession:YP_003065524.1
Gene range:+(1113332, 1114045)Protein Length:237aa
Gene description:geranyltranstransferase protein
COG prediction:[H] Geranylgeranyl pyrophosphate synthase
KEGG prediction:geranyltranstransferase protein; K00795 farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
SEED prediction:Octaprenyl-diphosphate synthase (EC 2.5.1.-) / Dimethylallyltransferase (EC 2.5.1.1) / Geranyltranstransferase (farnesyldiphosphate synthase) (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
Pathway involved in KEGG:Terpenoid backbone biosynthesis [PATH:las00900]
Subsystem involved in SEED:Isoprenoid Biosynthesis;
Polyprenyl Diphosphate Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MNGGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLPKK
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHccccccccccHcccccccccEEcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccEccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHEHHHHHHHHHHcccc
mngglpsklqenSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSlihddlpsmdngyirrgkptvhiqyDEVTAIIAGNGLLTYAFEIisspktqlkDNIRSQLMLSLTHNiglqgmlggqmldiQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLdceedlpkk
mngglpsklqenSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLPKK
MNGGLPSKLQENSKRIDTIlddlllQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIglqgmlggqmlDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQladdlldceedlPKK
**GGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEED****
********LQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLPKK
MNGGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLPKK
MNGGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLPKK
MNGGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDLPKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target237 geranyltranstransferase protein [Candidatus Liberibacte
254780755 322 octaprenyl-diphosphate synthase protein [Candidatu 2e-17
>gi|254780755|ref|YP_003065168.1| octaprenyl-diphosphate synthase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 322 Back     alignment 
 Score = 80.5 bits (197), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 100/190 (52%), Gaps = 11/190 (5%)

Query: 42  AIRYALL-GGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYI 100
            ++Y +  GGK++R  L    A +        + +  AIE IH  +L+HDD+  +D+  +
Sbjct: 33  VVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDV--VDDSAL 90

Query: 101 RRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIG-LQGM 159
           RRGK    + +   T+++ G+ LL+ AF ++   K+Q  + + +  +++ T   G L+ +
Sbjct: 91  RRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQ--EALEALSLVACTLAEGELRQL 148

Query: 160 LGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGI 219
              + LD+ +E         + K KT  L   A E  +++A    + ++ L+ +G NLGI
Sbjct: 149 SLSKNLDVTEE-----DYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGI 203

Query: 220 IFQLADDLLD 229
            FQL DD+LD
Sbjct: 204 AFQLVDDVLD 213

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target237 geranyltranstransferase protein [Candidatus Liberibacte
315122480297 geranyltranstransferase protein [Candidatus Liberibacte 1 3e-93
190893863327 geranyltranstransferase [Rhizobium etli CIAT 652] Lengt 1 7e-54
319899404301 geranyltranstransferase [Bartonella clarridgeiae 73] Le 1 1e-53
319404799300 geranyltranstransferase [Bartonella rochalimae ATCC BAA 1 2e-53
218463158304 geranyltranstransferase protein [Rhizobium etli Kim 5] 1 2e-53
327191787387 geranyltranstransferase protein [Rhizobium etli CNPAF51 1 3e-53
86359590331 geranyltranstransferase protein [Rhizobium etli CFN 42] 1 6e-53
153008460304 polyprenyl synthetase [Ochrobactrum anthropi ATCC 49188 1 6e-53
319406284300 geranyltranstransferase [Bartonella sp. AR 15-3] Length 1 1e-52
49474704301 geranyltranstransferase (farnesyl-diphosphate synthase) 1 2e-52
>gi|315122480|ref|YP_004062969.1| geranyltranstransferase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 297 Back     alignment and organism information
 Score =  345 bits (885), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 167/233 (71%), Positives = 197/233 (84%), Gaps = 4/233 (1%)

Query: 1   MNGGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTE 60
           MN  L  KLQENS++I+++L+DLL    SH  +  NDRL SAIRYA+LGGK IRSFLV E
Sbjct: 1   MNDDLLLKLQENSQKIESLLNDLL----SHQSSYLNDRLRSAIRYAILGGKNIRSFLVAE 56

Query: 61  CASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAG 120
           CASLF +++ T LRVGAAIEC+HCYSLIHDDLPSMDNGYIRRGKPT+H+QYDE TAI+AG
Sbjct: 57  CASLFGLSNPTVLRVGAAIECVHCYSLIHDDLPSMDNGYIRRGKPTLHLQYDEATAILAG 116

Query: 121 NGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMI 180
           N LLTYAFEII SP+TQLKD+IRS+L LSL  N G+QGMLGGQMLDIQ+E +DE Q+  I
Sbjct: 117 NSLLTYAFEIICSPETQLKDSIRSELTLSLARNAGIQGMLGGQMLDIQNECLDEKQLLTI 176

Query: 181 QKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEED 233
           Q+MKTG+LM FACE+GAI+AH +Q EK RLR +GENLGI+FQL DDLLD EE+
Sbjct: 177 QEMKTGSLMRFACEAGAIIAHTNQEEKARLRYYGENLGIVFQLVDDLLDFEEN 229



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190893863|ref|YP_001980405.1| geranyltranstransferase [Rhizobium etli CIAT 652] Length = 327 Back     alignment and organism information
>gi|319899404|ref|YP_004159501.1| geranyltranstransferase [Bartonella clarridgeiae 73] Length = 301 Back     alignment and organism information
>gi|319404799|emb|CBI78400.1| geranyltranstransferase [Bartonella rochalimae ATCC BAA-1498] Length = 300 Back     alignment and organism information
>gi|218463158|ref|ZP_03503249.1| geranyltranstransferase protein [Rhizobium etli Kim 5] Length = 304 Back     alignment and organism information
>gi|327191787|gb|EGE58789.1| geranyltranstransferase protein [Rhizobium etli CNPAF512] Length = 387 Back     alignment and organism information
>gi|86359590|ref|YP_471482.1| geranyltranstransferase protein [Rhizobium etli CFN 42] Length = 331 Back     alignment and organism information
>gi|153008460|ref|YP_001369675.1| polyprenyl synthetase [Ochrobactrum anthropi ATCC 49188] Length = 304 Back     alignment and organism information
>gi|319406284|emb|CBI79921.1| geranyltranstransferase [Bartonella sp. AR 15-3] Length = 300 Back     alignment and organism information
>gi|49474704|ref|YP_032746.1| geranyltranstransferase (farnesyl-diphosphate synthase) [Bartonella quintana str. Toulouse] Length = 301 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target237 geranyltranstransferase protein [Candidatus Liberibacte
cd00685259 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Syn 5e-44
COG0142322 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [C 1e-43
PRK10581299 PRK10581, PRK10581, geranyltranstransferase; Provisiona 7e-38
KOG0776384 KOG0776, KOG0776, KOG0776, Geranylgeranyl pyrophosphate 2e-30
cd00867236 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Syntha 1e-29
CHL00151323 CHL00151, preA, prenyl transferase; Reviewed 2e-21
TIGR02748319 TIGR02748, GerC3_HepT, heptaprenyl diphosphate synthase 8e-17
PRK10888323 PRK10888, PRK10888, octaprenyl diphosphate synthase; Pr 4e-16
PLN02857416 PLN02857, PLN02857, octaprenyl-diphosphate synthase 1e-14
TIGR02749322 TIGR02749, prenyl_cyano, solanesyl diphosphate synthase 1e-12
KOG0711347 KOG0711, KOG0711, KOG0711, Polyprenyl synthetase [Coenz 2e-08
KOG0777 322 KOG0777, KOG0777, KOG0777, Geranylgeranyl pyrophosphate 9e-08
pfam00348260 pfam00348, polyprenyl_synt, Polyprenyl synthetase 2e-45
cd00385243 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis 1e-20
PLN02890 422 PLN02890, PLN02890, geranyl diphosphate synthase 1e-06
>gnl|CDD|173833 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>gnl|CDD|30491 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|182567 PRK10581, PRK10581, geranyltranstransferase; Provisional Back     alignment and domain information
>gnl|CDD|35995 KOG0776, KOG0776, KOG0776, Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>gnl|CDD|164542 CHL00151, preA, prenyl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|131795 TIGR02748, GerC3_HepT, heptaprenyl diphosphate synthase component II Back     alignment and domain information
>gnl|CDD|182813 PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|178448 PLN02857, PLN02857, octaprenyl-diphosphate synthase Back     alignment and domain information
>gnl|CDD|131796 TIGR02749, prenyl_cyano, solanesyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|35930 KOG0711, KOG0711, KOG0711, Polyprenyl synthetase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|35996 KOG0777, KOG0777, KOG0777, Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|144078 pfam00348, polyprenyl_synt, Polyprenyl synthetase Back     alignment and domain information
>gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>gnl|CDD|178478 PLN02890, PLN02890, geranyl diphosphate synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 237 geranyltranstransferase protein [Candidatus Liberibacte
PRK10581299 geranyltranstransferase; Provisional 100.0
PRK10888323 octaprenyl diphosphate synthase; Provisional 100.0
COG0142322 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme me 100.0
CHL00151288 preA prenyl transferase; Reviewed 100.0
TIGR02749325 prenyl_cyano solanesyl diphosphate synthase; InterPro: 100.0
TIGR02748325 GerC3_HepT heptaprenyl diphosphate synthase component I 100.0
KOG0776384 consensus 100.0
KOG0711347 consensus 100.0
pfam00348260 polyprenyl_synt Polyprenyl synthetase. 100.0
cd00685298 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases (Tr 100.0
cd00867236 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases (Trans 100.0
KOG0777 322 consensus 100.0
cd00385243 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, C 99.94
pfam07307212 HEPPP_synt_1 Heptaprenyl diphosphate synthase (HEPPP sy 94.54
TIGR03464 266 HpnC squalene synthase HpnC. This family of genes are m 94.08
cd00683265 Trans_IPPS_HH Trans-Isoprenyl Diphosphate Synthases (Tr 94.03
TIGR03465 266 HpnD squalene synthase HpnD. The genes of this family a 93.93
pfam00494262 SQS_PSY Squalene/phytoene synthase. 93.61
>PRK10581 geranyltranstransferase; Provisional Back     alignment and domain information
>PRK10888 octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>COG0142 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>CHL00151 preA prenyl transferase; Reviewed Back     alignment and domain information
>TIGR02749 prenyl_cyano solanesyl diphosphate synthase; InterPro: IPR014120 This entry contains solanesyl diphosphate synthases from cyanobacteria or plastid-containing eukaryotes Back     alignment and domain information
>TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II; InterPro: IPR014119 The proteins in this entry are component II of the heterodimeric heptaprenyl diphosphate synthase Back     alignment and domain information
>KOG0776 consensus Back     alignment and domain information
>KOG0711 consensus Back     alignment and domain information
>pfam00348 polyprenyl_synt Polyprenyl synthetase Back     alignment and domain information
>cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS), head-to-tail (HT) (1'-4) condensation reactions Back     alignment and domain information
>cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS) of class 1 isoprenoid biosynthesis enzymes which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate Back     alignment and domain information
>KOG0777 consensus Back     alignment and domain information
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1; Superfamily of trans-isoprenyl diphosphate synthases (IPPS) and class I terpene cyclases which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate Back     alignment and domain information
>pfam07307 HEPPP_synt_1 Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1 Back     alignment and domain information
>TIGR03464 HpnC squalene synthase HpnC Back     alignment and domain information
>cd00683 Trans_IPPS_HH Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS), head-to-head (HH) (1'-1) condensation reaction Back     alignment and domain information
>TIGR03465 HpnD squalene synthase HpnD Back     alignment and domain information
>pfam00494 SQS_PSY Squalene/phytoene synthase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target237 geranyltranstransferase protein [Candidatus Liberibacte
3kra_A295 Mint Heterotetrameric Geranyl Pyrophosphate Synthas 8e-30
2j1p_A293 Geranylgeranyl Diphosphate Synthase From Sinapis Al 3e-27
2h8o_A335 The 1.6a Crystal Structure Of The Geranyltransferas 3e-27
3mzv_A 341 Crystal Structure Of A Decaprenyl Diphosphate Synth 2e-25
2for_A323 Crystal Structure Of The Shigella Flexneri Farnesyl 3e-25
1rqj_A299 Active Conformation Of Farnesyl Pyrophosphate Synth 5e-25
1rqi_A300 Active Conformation Of Farnesyl Pyrophosphate Synth 5e-25
2j1o_A268 Geranylgeranyl Diphosphate Synthase From Sinapis Al 1e-24
3lji_A304 Crystal Structure Of Putative Geranyltranstransfera 1e-24
3p41_A303 Crystal Structure Of Polyprenyl Synthetase From Pse 3e-24
3lvs_A298 Crystal Structure Of Farnesyl Diphosphate Synthase 4e-24
1wy0_A 342 Crystal Structure Of Geranylgeranyl Pyrophosphate S 6e-24
3p8r_A302 Crystal Structure Of Polyprenyl Synthase From Vibri 3e-23
3p8l_A302 Crystal Structure Of Polyprenyl Synthase From Enter 1e-22
3lmd_A 360 Crystal Structure Of Geranylgeranyl Pyrophosphate S 1e-21
1rtr_A301 Crystal Structure Of S. Aureus Farnesyl Pyrophospha 4e-21
3m0g_A297 Crystal Structure Of Putative Farnesyl Diphosphate 7e-21
3oyr_A345 Crystal Structure Of Polyprenyl Synthase From Caulo 5e-20
3m9u_A309 Crystal Structure Of Geranylgeranyl Pyrophosphate S 1e-19
3lom_A313 Crystal Structure Of Geranyltransferase From Legion 2e-19
3aqb_B 325 M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphospha 2e-19
3llw_A311 Crystal Structure Of Geranyltransferase From Helico 2e-17
3q1o_A310 Crystal Structure Of Geranyltransferase From Helico 3e-17
1wmw_A 330 Crystal Structure Of Geranulgeranyl Diphosphate Syn 4e-16
3lk5_A 380 Crystal Structure Of Putative Geranylgeranyl Pyroph 7e-16
3ipi_A295 Crystal Structure Of A Geranyltranstransferase From 3e-13
3npk_A291 The Crystal Structure Of Geranyltranstransferase Fr 1e-12
3qkc_B273 Crystal Structure Of Geranyl Diphosphate Synthase S 1e-12
3apz_A348 Apo Form Of Arabidopsis MediumLONG-Chain Length Pre 2e-12
3aq0_A348 Ligand-Bound Form Of Arabidopsis MediumLONG-Chain L 4e-12
3rmg_A 334 Crystal Structure Of Geranylgeranyl Pyrophosphate S 2e-11
3n3d_A 335 Crystal Structure Of Geranylgeranyl Pyrophosphate S 3e-11
3pko_A334 Crystal Structure Of Geranylgeranyl Pyrophosphate S 3e-11
1ubx_A367 Structure Of Farnesyl Pyrophosphate Synthetase Leng 4e-10
1ubv_A367 Structure Of Farnesyl Pyrophosphate Synthetase Leng 4e-10
2ihi_B395 Crystal Structure Of Plasmodium Vivax Putative Farn 3e-09
3cc9_A396 Crystal Structure Of Plasmodium Vivax Putative Poly 3e-09
1yq7_A374 Human Farnesyl Diphosphate Synthase Complexed With 8e-09
2qis_A374 Crystal Structure Of Human Farnesyl Pyrophosphate S 9e-09
1zw5_A355 X-Ray Structure Of Farnesyl Diphosphate Synthase Pr 9e-09
3kra_B274 Mint Heterotetrameric Geranyl Pyrophosphate Synthas 1e-08
3b7l_A356 Human Farnesyl Diphosphate Synthase Complexed With 1e-08
2rah_A378 Human Fdps Synthase In Complex With Novel Inhibitor 1e-08
3cp6_A376 Crystal Structure Of Human Farnesyl Diphosphate Syn 2e-08
1yhk_A362 Trypanosoma Cruzi Farnesyl Diphosphate Synthase Len 7e-08
3oab_B264 Mint Deletion Mutant Of Heterotetrameric Geranyl Py 1e-07
1v4h_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-07
1vg3_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 3e-07
1vg2_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 5e-07
1v4k_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 5e-07
1v4j_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 6e-07
1v4e_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 8e-07
1wl1_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 9e-07
1vg6_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
2azl_A299 Crystal Structure For The Mutant F117e Of Thermotog 1e-06
1wl2_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
1wl3_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
1vg4_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
1vg7_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
1v4i_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
2dh4_A 340 Geranylgeranyl Pyrophosphate Synthase Length = 340 1e-06
2azk_A289 Crystal Structure For The Mutant W136e Of Sulfolobu 2e-06
2azj_A289 Crystal Structure For The Mutant D81c Of Sulfolobus 3e-06
1wkz_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-05
3egt_A413 T. Brucei Farnesyl Diphosphate Synthase Complexed W 2e-05
2ewg_A390 T. Brucei Farnesyl Diphosphate Synthase Complexed W 2e-05
1wl0_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 5e-05
1yhm_A362 Structure Of The Complex Of Trypanosoma Cruzi Farne 1e-04
2her_B 368 Cryptosporidium Parvum Putative Polyprenyl Pyrophos 6e-04
3nf2_A 352 Crystal Structure Of Polyprenyl Synthetase From Str 3e-16
2ftz_A284 Crystal Structure Of Geranyltranstransferase (Ec 2. 1e-13
1fps_A348 Crystal Structure Of Recombinant Farnesyl Diphospha 2e-10
2f7m_F350 Crystal Structure Of Unliganded Human Fpps Length = 3e-08
2q80_A301 Crystal Structure Of Human Geranylgeranyl Pyrophosp 6e-05
>gi|289526777|pdb|3KRA|A Chain A, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium Length = 295 Back     alignment and structure 
 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 73/233 (31%), Positives = 125/233 (53%), Gaps = 11/233 (4%)

Query: 3   GGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALL-GGKKIRSFLVTEC 61
                 +   +K ++  L+       + +Q +   ++  ++RY+LL GGK++R  L    
Sbjct: 2   FDFDGYMLRKAKSVNKALE-------AAVQMKEPLKIHESMRYSLLAGGKRVRPMLCIAA 54

Query: 62  ASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGN 121
             L   +  TA+    A+E IH  SL+HDDLP MDN  +RRGKPT H+ + E  A++AG+
Sbjct: 55  CELVGGDESTAMPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAGD 114

Query: 122 GLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDE---TQVF 178
            LL++AFE +++           +++  L  +IG +G++ GQ++D+  E + E     + 
Sbjct: 115 ALLSFAFEHVAAATKGAPPERIVRVLGELAVSIGSEGLVAGQVVDVCSEGMAEVGLDHLE 174

Query: 179 MIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCE 231
            I   KT AL+  +   GAI+    + E  +LR F   +G++FQ+ DD+LD  
Sbjct: 175 FIHHHKTAALLQGSVVLGAILGGGKEEEVAKLRKFANCIGLLFQVVDDILDVT 227
>gi|126030920|pdb|2J1P|A Chain A, Geranylgeranyl Diphosphate Synthase From Sinapis Alba In Complex With Ggpp Length = 293 Back     alignment and structure
>gi|110590588|pdb|2H8O|A Chain A, The 1.6a Crystal Structure Of The Geranyltransferase From Agrobacterium Tumefaciens Length = 335 Back     alignment and structure
>gi|297787795|pdb|3MZV|A Chain A, Crystal Structure Of A Decaprenyl Diphosphate Synthase From Rhodobacter Capsulatus Length = 341 Back     alignment and structure
>gi|88193100|pdb|2FOR|A Chain A, Crystal Structure Of The Shigella Flexneri Farnesyl Pyrophosphate Synthase Complex With An Isopentenyl Pyrophosphate Length = 323 Back     alignment and structure
gi|46015527|pdb|1RQJ|A Chain A, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Risedronate Length = 299 Back     alignment and structure
>gi|46015525|pdb|1RQI|A Chain A, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Dimethylallyl S- Thiolodiphosphate Length = 300 Back     alignment and structure
>gi|126030919|pdb|2J1O|A Chain A, Geranylgeranyl Diphosphate Synthase From Sinapis Alba Length = 268 Back     alignment and structure
>gi|288563197|pdb|3LJI|A Chain A, Crystal Structure Of Putative Geranyltranstransferase From Pseudomonas Fluorescens Pf-5 Length = 304 Back     alignment and structure
>gi|309320748|pdb|3P41|A Chain A, Crystal Structure Of Polyprenyl Synthetase From Pseudomonas Fluorescens Pf-5 Complexed With Magnesium And Isoprenyl Pyrophosphate Length = 303 Back     alignment and structure
>gi|290790316|pdb|3LVS|A Chain A, Crystal Structure Of Farnesyl Diphosphate Synthase From Rhodobacter Capsulatus Sb1003 Length = 298 Back     alignment and structure
gi|90108478|pdb|1WY0|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthetase From Pyrococcus Horikoshii Ot3 Length = 342 Back     alignment and structure
>gi|310689999|pdb|3P8R|A Chain A, Crystal Structure Of Polyprenyl Synthase From Vibrio Cholerae Length = 302 Back     alignment and structure
>gi|310943001|pdb|3P8L|A Chain A, Crystal Structure Of Polyprenyl Synthase From Enterococcus Faecalis V583 Length = 302 Back     alignment and structure
>gi|288965865|pdb|3LMD|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Corynebacterium Glutamicum Atcc 13032 Length = 360 Back     alignment and structure
>gi|46015555|pdb|1RTR|A Chain A, Crystal Structure Of S. Aureus Farnesyl Pyrophosphate Synthase Length = 301 Back     alignment and structure
>gi|292659826|pdb|3M0G|A Chain A, Crystal Structure Of Putative Farnesyl Diphosphate Synthase From Rhodobacter Capsulatus Length = 297 Back     alignment and structure
>gi|308388198|pdb|3OYR|A Chain A, Crystal Structure Of Polyprenyl Synthase From Caulobacter Crescentus Cb15 Complexed With Calcium And Isoprenyl Diphosphate Length = 345 Back     alignment and structure
>gi|293652046|pdb|3M9U|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Length = 309 Back     alignment and structure
>gi|288965921|pdb|3LOM|A Chain A, Crystal Structure Of Geranyltransferase From Legionella Pneumophila Length = 313 Back     alignment and structure
>gi|311772001|pdb|3AQB|B Chain B, M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphosphate Synthase In Complex With Magnesium Length = 325 Back     alignment and structure
>gi|292659743|pdb|3LLW|A Chain A, Crystal Structure Of Geranyltransferase From Helicobacter Pylori 26695 Length = 311 Back     alignment and structure
>gi|317455530|pdb|3Q1O|A Chain A, Crystal Structure Of Geranyltransferase From Helicobacter Pylori Complexed With Magnesium And Isoprenyl Diphosphate Length = 310 Back     alignment and structure
gi|73535442|pdb|1WMW|A Chain A, Crystal Structure Of Geranulgeranyl Diphosphate Synthase From Thermus Thermophilus Length = 330 Back     alignment and structure
>gi|290790227|pdb|3LK5|A Chain A, Crystal Structure Of Putative Geranylgeranyl Pyrophosphate Synthase From Corynebacterium Glutamicum Length = 380 Back     alignment and structure
>gi|257472035|pdb|3IPI|A Chain A, Crystal Structure Of A Geranyltranstransferase From The Methanosarcina Mazei Length = 295 Back     alignment and structure
>gi|300508789|pdb|3NPK|A Chain A, The Crystal Structure Of Geranyltranstransferase From Campylobacter Jejuni Length = 291 Back     alignment and structure
>gi|323463187|pdb|3QKC|B Chain B, Crystal Structure Of Geranyl Diphosphate Synthase Small Subunit From Antirrhinum Majus Length = 273 Back     alignment and structure
>gi|319443460|pdb|3APZ|A Chain A, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase Length = 348 Back     alignment and structure
>gi|319443462|pdb|3AQ0|A Chain A, Ligand-Bound Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase (Surface Polar Residue Mutant) Length = 348 Back     alignment and structure
>gi|332639921|pdb|3RMG|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Bacteroides Thetaiotaomicron Length = 334 Back     alignment and structure
>gi|297343242|pdb|3N3D|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase F Lactobacillus Brevis Atcc 367 Length = 335 Back     alignment and structure
>gi|312597572|pdb|3PKO|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Complexed With Citrate Length = 334 Back     alignment and structure
>gi|157834060|pdb|1UBX|A Chain A, Structure Of Farnesyl Pyrophosphate Synthetase Length = 367 Back     alignment and structure
>gi|157834058|pdb|1UBV|A Chain A, Structure Of Farnesyl Pyrophosphate Synthetase Length = 367 Back     alignment and structure
>gi|170785230|pdb|3CC9|A Chain A, Crystal Structure Of Plasmodium Vivax Putative Polyprenyl Pyrophosphate Synthase In Complex With Geranylgeranyl Diphosphate Length = 396 Back     alignment and structure
>gi|61680786|pdb|1YQ7|A Chain A, Human Farnesyl Diphosphate Synthase Complexed With Risedronate Length = 374 Back     alignment and structure
>gi|157835943|pdb|2QIS|A Chain A, Crystal Structure Of Human Farnesyl Pyrophosphate Synthase T210s Mutant Bound To Risedronate Length = 374 Back     alignment and structure
>gi|71042523|pdb|1ZW5|A Chain A, X-Ray Structure Of Farnesyl Diphosphate Synthase Protein Length = 355 Back     alignment and structure
>gi|289526778|pdb|3KRA|B Chain B, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium Length = 274 Back     alignment and structure
>gi|160286554|pdb|3B7L|A Chain A, Human Farnesyl Diphosphate Synthase Complexed With Mg And Minodronate Length = 356 Back     alignment and structure
>gi|158430745|pdb|2RAH|A Chain A, Human Fdps Synthase In Complex With Novel Inhibitor Length = 378 Back     alignment and structure
>gi|183448387|pdb|3CP6|A Chain A, Crystal Structure Of Human Farnesyl Diphosphate Synthase (T201a Mutant) Complexed With Mg And Biphosphonate Inhibitor Length = 376 Back     alignment and structure
>gi|85543983|pdb|1YHK|A Chain A, Trypanosoma Cruzi Farnesyl Diphosphate Synthase Length = 362 Back     alignment and structure
>gi|310942864|pdb|3OAB|B Chain B, Mint Deletion Mutant Of Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Ligands Length = 264 Back     alignment and structure
>gi|46015921|pdb|1V4H|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F52a Mutant Length = 299 Back     alignment and structure
>gi|49259555|pdb|1VG3|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima A76yS77F MUTANT Length = 299 Back     alignment and structure
>gi|49259554|pdb|1VG2|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima A76y Mutant Length = 299 Back     alignment and structure
>gi|46015925|pdb|1V4K|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima S77f Mutant Length = 299 Back     alignment and structure
>gi|46015923|pdb|1V4J|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima V73y Mutant Length = 299 Back     alignment and structure
gi|46015919|pdb|1V4E|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima Length = 299 Back     alignment and structure
>gi|71041845|pdb|1WL1|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima H74a Mutant Length = 299 Back     alignment and structure
>gi|49259558|pdb|1VG6|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128AI123A Mutant Length = 299 Back     alignment and structure
>gi|93278762|pdb|2AZL|A Chain A, Crystal Structure For The Mutant F117e Of Thermotoga Maritima Octaprenyl Pyrophosphate Synthase Length = 299 Back     alignment and structure
>gi|71041847|pdb|1WL2|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima R90a Mutant Length = 299 Back     alignment and structure
>gi|71041848|pdb|1WL3|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima R91a Mutant Length = 299 Back     alignment and structure
>gi|49259556|pdb|1VG4|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128A MUTANT Length = 299 Back     alignment and structure
>gi|49259559|pdb|1VG7|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128AI123AD62A MUTANT Length = 299 Back     alignment and structure
>gi|46015922|pdb|1V4I|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132a Mutant Length = 299 Back     alignment and structure
>gi|93279242|pdb|2DH4|A Chain A, Geranylgeranyl Pyrophosphate Synthase Length = 340 Back     alignment and structure
>gi|93278760|pdb|2AZK|A Chain A, Crystal Structure For The Mutant W136e Of Sulfolobus Solfataricus Hexaprenyl Pyrophosphate Synthase Length = 289 Back     alignment and structure
>gi|93278758|pdb|2AZJ|A Chain A, Crystal Structure For The Mutant D81c Of Sulfolobus Solfataricus Hexaprenyl Pyrophosphate Synthase Length = 289 Back     alignment and structure
>gi|71041841|pdb|1WKZ|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima K41a Mutant Length = 299 Back     alignment and structure
>gi|229597840|pdb|3EGT|A Chain A, T. Brucei Farnesyl Diphosphate Synthase Complexed With Bisphosphonate Bph-722 Length = 413 Back     alignment and structure
>gi|118137651|pdb|2EWG|A Chain A, T. Brucei Farnesyl Diphosphate Synthase Complexed With Minodronate Length = 390 Back     alignment and structure
>gi|71041843|pdb|1WL0|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima R44a Mutant Length = 299 Back     alignment and structure
>gi|85543985|pdb|1YHM|A Chain A, Structure Of The Complex Of Trypanosoma Cruzi Farnesyl Disphosphate Synthase With Alendronate, Isopentenyl Diphosphate And Mg+2 Length = 362 Back     alignment and structure
>gi|302148849|pdb|3NF2|A Chain A, Crystal Structure Of Polyprenyl Synthetase From Streptomyces Coelicolor A3(2) Length = 352 Back     alignment and structure
>gi|90109651|pdb|2FTZ|A Chain A, Crystal Structure Of Geranyltranstransferase (Ec 2.5.1.10) (Tm0161) From Thermotoga Maritima At 1.90 A Resolution Length = 284 Back     alignment and structure
>gi|157831115|pdb|1FPS|A Chain A, Crystal Structure Of Recombinant Farnesyl Diphosphate Synthase At 2.6 Angstroms Resolution Length = 348 Back     alignment and structure
>gi|90109287|pdb|2F7M|F Chain F, Crystal Structure Of Unliganded Human Fpps Length = 350 Back     alignment and structure
>gi|150261574|pdb|2Q80|A Chain A, Crystal Structure Of Human Geranylgeranyl Pyrophosphate Synthase Bound To Ggpp Length = 301 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target237 geranyltranstransferase protein [Candidatus Liberibacte
3lom_A313 Geranyltranstransferase; geranyltransferase, structural 1e-44
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, structural 4e-41
3kra_B274 Geranyl diphosphate synthase small subunit; prenyltrans 4e-41
3lsn_A304 Geranyltranstransferase; structural genomics, protein s 1e-40
3m0g_A297 Farnesyl diphosphate synthase; structural genomics, pro 1e-38
3lji_A304 Geranyltranstransferase; structural genomics, protein s 6e-38
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, structural 4e-37
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphosphate sy 1e-36
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SGX, st 2e-36
3llw_A311 Geranyltranstransferase (ISPA); structural genomics, PS 2e-36
3lmd_A 360 Geranylgeranyl pyrophosphate synthase; isoprenyl diphos 4e-36
3nf2_A 352 Putative polyprenyl synthetase; isoprenyl diphosphate s 7e-36
3mzv_A 341 Decaprenyl diphosphate synthase; transferase, structura 5e-34
3lk5_A 380 Geranylgeranyl pyrophosphate synthase; structural genom 3e-33
2h8o_A335 Geranyltranstransferase; geranyltransferase,agrobacteri 2e-32
3oyr_A 345 Trans-isoprenyl diphosphate synthase; isoprenyl synthas 2e-31
3n3d_A 335 Geranylgeranyl pyrophosphate synthase; isoprenyl diphos 2e-31
3aqb_B 325 Component B of hexaprenyl diphosphate synthase; prenylt 1e-30
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transferase, i 8e-27
2her_A 368 Fragment, farnesyl pyrophosphate synthase; farnesyl dip 6e-26
2ihi_A395 Pyrophosphate synthase; PV092040, structural genomics, 5e-25
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltransfer 5e-24
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl synt 2e-23
3dyh_A390 Farnesyl pyrophosphate synthase; protein-bisphosphonate 2e-21
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, isopre 2e-20
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aureus} 9e-20
1wy0_A 342 Geranylgeranyl pyrophosphate synthetase; structural gen 4e-19
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosphate s 3e-17
2ftz_A284 Geranyltranstransferase; TM0161, structural genomics, j 3e-17
1wmw_A 330 Geranylgeranyl diphosphate synthetase; GGPP, prenyl dip 6e-15
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, helical 6e-14
2e8v_A 340 Geranylgeranyl pyrophosphate synthetase; prenyltransfer 2e-13
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoid pat 3e-13
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyltrans 5e-11
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, trans- 2e-10
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Length = 313 Back     alignment and structure
 Score =  174 bits (442), Expect = 1e-44
 Identities = 80/231 (34%), Positives = 124/231 (53%), Gaps = 11/231 (4%)

Query: 9   LQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALL-GGKKIRSFLVTECASLFNV 67
           + + ++R +  L+ LL +           ++ SA+ YAL  GGK+IR  LV     L +V
Sbjct: 13  IDKYTQRHELYLEQLLNEIIIP-----APQIRSALHYALFSGGKRIRPILVYLAGDLIDV 67

Query: 68  NHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYA 127
           +      + AA+E  HCYSLIHDDLP+MDN  +RRGKP+ H  +DE TAI+ G+G+   A
Sbjct: 68  DQGVLDIIAAALELTHCYSLIHDDLPAMDNDDLRRGKPSCHKAFDEATAILVGDGMQALA 127

Query: 128 FEIISSPKTQLKDNIRS-QLMLSLTHNIGLQGMLGGQMLDIQDEF---IDETQVFMIQKM 183
            E++    + L    +   +   L +  G+ GM+ GQ LD+ +     + E Q+  I  +
Sbjct: 128 IEVLLMRLSPLLPAAQVVAITQVLVNASGISGMVSGQSLDLSELAKSSVTEEQLREIHLL 187

Query: 184 KTGALMCFACE-SGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEED 233
           KTG L+    E   A     S+  K  LR +G+++G++FQ+ DD LD    
Sbjct: 188 KTGKLILACFEMVLAAQHEVSEQIKSALRTYGKHIGLVFQMQDDYLDLYAP 238
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Length = 302 Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* Length = 274 Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* Length = 304 Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, isoprene biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Length = 297 Back     alignment and structure
>3lji_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.39A {Pseudomonas fluorescens} Length = 304 Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} Length = 302 Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Length = 309 Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Length = 291 Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} Length = 311 Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} Length = 360 Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Length = 352 Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Length = 341 Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative; 1.90A {Corynebacterium glutamicum} Length = 380 Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural genomics, PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens str} Length = 335 Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Length = 345 Back     alignment and structure
>3n3d_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.40A {Lactobacillus brevis} Length = 335 Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Length = 325 Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A Length = 293 Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural genomics consortium, SGC; HET: RIS; 1.80A {Homo sapiens} PDB: 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 2f94_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* Length = 374 Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Length = 299 Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Length = 390 Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Length = 367 Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.20A {Pyrococcus horikoshii OT3} Length = 342 Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl allyl pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* Length = 362 Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima MSB8} Length = 284 Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genomics; 1.55A {Thermus thermophilus HB8} Length = 330 Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Length = 295 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Length = 340 Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural genomics, structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Length = 299 Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Length = 289 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target237 geranyltranstransferase protein [Candidatus Liberibacte
2h8o_A335 Geranyltranstransferase; geranyltransferase,agrobacteri 100.0
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl synt 100.0
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, structural 100.0
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphosphate sy 100.0
1wy0_A 342 Geranylgeranyl pyrophosphate synthetase; structural gen 100.0
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transferase, i 100.0
3nf2_A 352 Putative polyprenyl synthetase; isoprenyl diphosphate s 100.0
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aureus} 100.0
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, structural 100.0
3lsn_A304 Geranyltranstransferase; structural genomics, protein s 100.0
3kra_B274 Geranyl diphosphate synthase small subunit; prenyltrans 100.0
3lmd_A 360 Geranylgeranyl pyrophosphate synthase; isoprenyl diphos 100.0
3mzv_A 341 Decaprenyl diphosphate synthase; transferase, structura 100.0
2e8v_A 340 Geranylgeranyl pyrophosphate synthetase; prenyltransfer 100.0
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, helical 100.0
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, trans- 100.0
3oyr_A 345 Trans-isoprenyl diphosphate synthase; isoprenyl synthas 100.0
3m0g_A297 Farnesyl diphosphate synthase; structural genomics, pro 100.0
3lom_A313 Geranyltranstransferase; geranyltransferase, structural 100.0
2ftz_A284 Geranyltranstransferase; TM0161, structural genomics, j 100.0
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltransfer 100.0
3lk5_A 380 Geranylgeranyl pyrophosphate synthase; structural genom 100.0
3aqb_B325 Component B of hexaprenyl diphosphate synthase; prenylt 100.0
3llw_A311 Geranyltranstransferase (ISPA); structural genomics, PS 100.0
3n3d_A 335 Geranylgeranyl pyrophosphate synthase; isoprenyl diphos 100.0
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SGX, st 100.0
3dyh_A390 Farnesyl pyrophosphate synthase; protein-bisphosphonate 100.0
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, isopre 100.0
2ihi_A395 Pyrophosphate synthase; PV092040, structural genomics, 100.0
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosphate s 100.0
2her_A 368 Fragment, farnesyl pyrophosphate synthase; farnesyl dip 100.0
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyltrans 100.0
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoid pat 100.0
1wmw_A 330 Geranylgeranyl diphosphate synthetase; GGPP, prenyl dip 100.0
1ezf_A 340 Farnesyl-diphosphate farnesyltransferase; isoprenoid sy 93.17
2zco_A 293 Dehydrosqualene synthase; CRTM, carotenoid biosynthesis 93.14
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural genomics, PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
Probab=100.00  E-value=0  Score=396.31  Aligned_cols=232  Identities=47%  Similarity=0.799  Sum_probs=208.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHC-CCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH
Q ss_conf             348999999999999999999997675302457157999998750-5860079999999999617882222402468888
Q gi|254781111|r    3 GGLPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYAL-LGGKKIRSFLVTECASLFNVNHLTALRVGAAIEC   81 (237)
Q Consensus         3 ~~l~~~l~~~~~~id~~l~~~l~~~~~~~~~~~~~~l~~~~~y~l-~gGKr~R~~l~l~~~~~~~~~~~~~~~~AaavEl   81 (237)
                      .+++.++++..++||+.|++++...........|+.+.++|+|.+ .||||+||.|++++++++|++.+.++++|+|+|+
T Consensus        37 ~~~~~~l~~~~~~ve~~l~~~l~~~~~~~~~~~p~~l~~a~~y~~~~GGKrlRp~L~l~~~~~~g~~~~~~~~~AaaiEl  116 (335)
T 2h8o_A           37 TNFETRLRENAAKTEALLGHLLSGEARADEITRPQNLLEAMRHGVLNGGKRLRPFLVIESVALLGGDAEAGLHVGAALEC  116 (335)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCSSCCTTCCCCCHHHHHHHHHHHHTSCSCHHHHHHHHHHHHTTCCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             67999999999999999998667523444457987899999998626841099999999999829987899999999999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99999864776544532234455665432434520133222233479999731023412678888876532223566411
Q gi|254781111|r   82 IHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLG  161 (237)
Q Consensus        82 lH~asLihDDI~~~D~s~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  161 (237)
                      +|++||||||||+||+|++|||+||+|++||++.|||+||+|++.+|+++++.............+..+.+..+..+++.
T Consensus       117 iH~aSLIHDDI~~mD~~~~RRG~pt~h~~~G~~~AIlaGD~L~~~a~~~l~~~~~~~~~~~~~~~i~~l~~~~~~~g~~~  196 (335)
T 2h8o_A          117 LHCYSLVHDDLPAMDDDDLRRGQPTVHRKFDEATAILAGDSLLTLAFDIIASDDNPLAAERKAALVISLARAAGIGGMAG  196 (335)
T ss_dssp             HHHHHHHHHTSTTTTCCSEETTEECHHHHSCHHHHHHHHHHHHHHHHHHHHSTTSCSCHHHHHHHHHHHHHHHSTTSHHH
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999997798768876333898650305185999999999999888998851220467888999999999999988864


Q ss_pred             CCCCCCCH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             33222100--00003679999999863489999999999759888999999999999849999986765344320
Q gi|254781111|r  162 GQMLDIQD--EFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEEDL  234 (237)
Q Consensus       162 GQ~~dl~~--~~~~~~~y~~i~~~KTa~lf~~~~~~ga~lag~~~~~~~~l~~~g~~lGiafQi~DD~lD~~~D~  234 (237)
                      ||..+...  ...+++.|.+|+++|||+||.++|.+|+++++++++..+.+.+||.++|++|||+||++|++||.
T Consensus       197 ~~~~~~~~~~~~~~~~~~~~i~~~KTg~L~~~a~~~ga~l~~~~~~~~~~l~~~g~~lGlAFQI~DDilD~~gd~  271 (335)
T 2h8o_A          197 GQALDLAAEKKAPDEDGIITLQAMKTGALLRFACEAGAIIAGSNQAERQRLRLFGEKIGLSFQLADDLLDLTADA  271 (335)
T ss_dssp             HHHHHHHHHHSCCCHHHHHHHHHHHTHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC---
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
T ss_conf             688887630454248999876202477989989998898804616799999999986302677555766511898
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.20A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, isoprene biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima MSB8} Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural genomics consortium, SGC; HET: RIS; 1.80A {Homo sapiens} PDB: 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* 3n1w_F* 3n3l_F* 2f94_F* ... Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative; 1.90A {Corynebacterium glutamicum} Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>3n3d_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.40A {Lactobacillus brevis} Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Back     alignment and structure