254781112

254781112

putative amino acid-binding periplasmic ABC transporter protein

GeneID in NCBI database:8210137Locus tag:CLIBASIA_05070
Protein GI in NCBI database:254781112Protein Accession:YP_003065525.1
Gene range:+(1114348, 1115172)Protein Length:274aa
Gene description:putative amino acid-binding periplasmic ABC transporter protein
COG prediction:[E] [T] ABC-type amino acid transport/signal transduction systems, periplasmic component/domain
KEGG prediction:putative amino acid-binding periplasmic ABC transporter protein; K02030 polar amino acid transport system substrate-binding protein
SEED prediction:PUTATIVE AMINO ACID-BINDING PERIPLASMIC ABC TRANSPORTER PROTEIN
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----
MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKNIISSVPGCSS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccEEEEEEEcccccEEEEcccccccccccHHHHHHHHHHHccccEEEEEccHHHHHHHHHcccccEEEEccccHHHHcccEEcccEEEccEEEEEEccccccccHHHHcccEEEEEccccHHHHHHHHcccEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccccEEEEcccccccccEEEEEccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccEEEccHHHHHHHHHHcccEEEEEccccccHHHHHHcccEEEccccEccHHHHcccEEccccEEEEEEEEEEcccccccccccccccEEEEEcccHHHHHHHHcccEEEEccccHHHHHHHHcccccEEEccHHHHHHHHHcccccccEEEEEccccccccEEEEEEcccHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccc
MRRLLRDLRKIFFSkylffapffILFSYYFVIypfrtedqsalrvgtdgiypphsfhaqdgrgeltgFDIDLIKEVAHRLNLKVEFFETAVSGLItgldtnrydVLVNVAitperqkkydfsipyiAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKrtdatmipdipffnflerrphdgnlfKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFdkniissvpgcss
MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGlitgldtnryDVLVNVAitperqkkydfsiPYIAHRVLLVVRSDQQDIRsfkdltdktVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKRTDATMIPDIpffnflerrpHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKniissvpgcss
MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKNIISSVPGCSS
**********IFFSKYLFFAPFFILFSYYFV********QSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKNIISS******
MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKNII********
MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKNIISS******
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKNIISSVPGCSS
MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKNIISSVPGCSS
MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKNIISSVPGCSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target274 putative amino acid-binding periplasmic ABC transporter
315122481274 putative amino acid-binding periplasmic ABC transporter 1 1e-112
15967027257 putative amino acid-binding periplasmic ABC transporter 1 8e-48
13473306267 amino acid ABC transporter, periplasmic amino acid-bind 1 3e-47
319781052257 extracellular solute-binding protein family 3 [Mesorhiz 1 3e-47
150398330257 extracellular solute-binding protein [Sinorhizobium med 1 6e-47
260461454257 extracellular solute-binding protein family 3 [Mesorhiz 1 1e-46
253574192281 amino acid ABC transporter [Paenibacillus sp. oral taxo 1 1e-46
118593287257 probable amino acid ABC transporter, substrate-binding 1 2e-46
259909461257 Putative amino-acid ABC transporter, periplasmic amino 1 4e-46
170751307261 extracellular solute-binding protein [Methylobacterium 1 4e-46
>gi|315122481|ref|YP_004062970.1| putative amino acid-binding periplasmic ABC transporter protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 274 Back     alignment and organism information
 Score =  407 bits (1047), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/274 (70%), Positives = 231/274 (84%)

Query: 1   MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQD 60
           M  L R  + IFF KY+ F P  I   YYF+IY    +DQS LRVGTDGIYPPHSFH+Q+
Sbjct: 1   MHHLFRYSKIIFFLKYMIFTPLLIFLLYYFIIYNPHIKDQSILRVGTDGIYPPHSFHSQN 60

Query: 61  GRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYD 120
           G+GEL GFDIDLIKE+AHRLNLK+ FFET V+GLITG+DTNRYDVLVNVAITP R+KKY 
Sbjct: 61  GKGELVGFDIDLIKEIAHRLNLKIVFFETMVNGLITGIDTNRYDVLVNVAITPSREKKYY 120

Query: 121 FSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQS 180
           FS PYI H VLL+VRSD+++I +F DLTDK V QILGTDLSR AKELK+HL+FSHNFEQS
Sbjct: 121 FSTPYITHNVLLIVRSDEKNIHNFNDLTDKIVVQILGTDLSRVAKELKAHLIFSHNFEQS 180

Query: 181 LQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSI 240
           LQLLLSKR +ATMI DIPFF+FL+  P++G+LFKIADR+K++S + FM+RKGN+KL ++I
Sbjct: 181 LQLLLSKRANATMIADIPFFDFLKHGPNNGHLFKIADRIKESSNIGFMIRKGNDKLKKAI 240

Query: 241 NEILCAIHLDGTYKKIFDRYFDKNIISSVPGCSS 274
           +E LCAIH DGTYKKIF +YF+K++IS+VP CSS
Sbjct: 241 DETLCAIHRDGTYKKIFSKYFEKDVISNVPICSS 274


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15967027|ref|NP_387380.1| putative amino acid-binding periplasmic ABC transporter protein [Sinorhizobium meliloti 1021] Length = 257 Back     alignment and organism information
>gi|13473306|ref|NP_104873.1| amino acid ABC transporter, periplasmic amino acid-binding protein [Mesorhizobium loti MAFF303099] Length = 267 Back     alignment and organism information
>gi|319781052|ref|YP_004140528.1| extracellular solute-binding protein family 3 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 257 Back     alignment and organism information
>gi|150398330|ref|YP_001328797.1| extracellular solute-binding protein [Sinorhizobium medicae WSM419] Length = 257 Back     alignment and organism information
>gi|260461454|ref|ZP_05809701.1| extracellular solute-binding protein family 3 [Mesorhizobium opportunistum WSM2075] Length = 257 Back     alignment and organism information
>gi|253574192|ref|ZP_04851534.1| amino acid ABC transporter [Paenibacillus sp. oral taxon 786 str. D14] Length = 281 Back     alignment and organism information
>gi|118593287|ref|ZP_01550672.1| probable amino acid ABC transporter, substrate-binding protein [Stappia aggregata IAM 12614] Length = 257 Back     alignment and organism information
>gi|259909461|ref|YP_002649817.1| Putative amino-acid ABC transporter, periplasmic amino acid-binding protein [Erwinia pyrifoliae Ep1/96] Length = 257 Back     alignment and organism information
>gi|170751307|ref|YP_001757567.1| extracellular solute-binding protein [Methylobacterium radiotolerans JCM 2831] Length = 261 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target274 putative amino acid-binding periplasmic ABC transporter
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate-bindi 9e-43
cd00134218 cd00134, PBPb, Bacterial periplasmic transport systems 2e-35
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signal tra 4e-33
TIGR01096250 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-bindin 6e-30
PRK11260266 PRK11260, PRK11260, cystine transporter subunit; Provis 6e-30
PRK09495247 PRK09495, glnH, glutamine ABC transporter periplasmic p 2e-20
PRK15437259 PRK15437, PRK15437, histidine ABC transporter substrate 4e-18
PRK15007243 PRK15007, PRK15007, putative ABC transporter arginine-b 2e-16
PRK10859 482 PRK10859, PRK10859, membrane-bound lytic transglycosyla 5e-14
PRK15010260 PRK15010, PRK15010, ABC transporter lysine/arginine/orn 2e-13
TIGR02995275 TIGR02995, ectoine_ehuB, ectoine/hydroxyectoine ABC tra 9e-10
COG4623 473 COG4623, COG4623, Predicted soluble lytic transglycosyl 1e-05
pfam00497224 pfam00497, SBP_bac_3, Bacterial extracellular solute-bi 2e-46
PRK11917259 PRK11917, PRK11917, bifunctional adhesin/ABC transporte 9e-07
PRK10797302 PRK10797, PRK10797, glutamate and aspartate transporter 7e-05
KOG1052 656 KOG1052, KOG1052, KOG1052, Glutamate-gated kainate-type 1e-04
>gnl|CDD|128376 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|29040 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|31176 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|162200 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>gnl|CDD|183061 PRK11260, PRK11260, cystine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|181908 PRK09495, glnH, glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>gnl|CDD|185334 PRK15437, PRK15437, histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>gnl|CDD|184969 PRK15007, PRK15007, putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>gnl|CDD|182785 PRK10859, PRK10859, membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>gnl|CDD|184972 PRK15010, PRK15010, ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>gnl|CDD|132040 TIGR02995, ectoine_ehuB, ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>gnl|CDD|34243 COG4623, COG4623, Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144186 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|183381 PRK11917, PRK11917, bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|182740 PRK10797, PRK10797, glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|36270 KOG1052, KOG1052, KOG1052, Glutamate-gated kainate-type ion channel receptor subunit GluR5 and related subunits [Inorganic ion transport and metabolism, Amino acid transport and metabolism, Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 274 putative amino acid-binding periplasmic ABC transporter
PRK11260264 cystine transporter subunit; Provisional 100.0
PRK10797302 glutamate and aspartate transporter subunit; Provisiona 100.0
TIGR01096333 3A0103s03R lysine-arginine-ornithine-binding periplasmi 100.0
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glutamat 100.0
TIGR02995285 ectoine_ehuB ectoine/hydroxyectoine ABC transporter sol 100.0
PRK09501348 potD spermidine/putrescine ABC transporter periplasmic 97.65
PRK09495247 glnH glutamine ABC transporter periplasmic protein; Rev 100.0
pfam00497224 SBP_bac_3 Bacterial extracellular solute-binding protei 100.0
smart00062219 PBPb Bacterial periplasmic substrate-binding proteins. 100.0
cd00134218 PBPb Bacterial periplasmic transport systems use membra 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 100.0
COG0834275 HisJ ABC-type amino acid transport/signal transduction 100.0
PRK10859 507 putative transglycosylase; Provisional 99.97
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 99.94
COG4623 473 Predicted soluble lytic transglycosylase fused to an AB 99.9
KOG1052656 consensus 99.57
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phosphona 99.52
TIGR01098299 3A0109s03R phosphonate ABC transporter, periplasmic pho 99.38
TIGR02285293 TIGR02285 conserved hypothetical protein; InterPro: IPR 99.36
COG3221299 PhnD ABC-type phosphate/phosphonate transport system, p 99.36
PRK11553314 alkanesulfonate transporter substrate-binding subunit; 99.17
KOG1054897 consensus 99.1
TIGR03427328 ABC_peri_uca ABC transporter periplasmic binding protei 98.92
PRK11480320 tauA taurine transporter substrate binding subunit; Pro 98.77
PRK09861272 cytoplasmic membrane lipoprotein-28; Provisional 98.23
PRK11063271 metQ DL-methionine transporter substrate-binding subuni 98.2
COG0725258 ModA ABC-type molybdate transport system, periplasmic c 98.13
COG4521334 TauA ABC-type taurine transport system, periplasmic com 98.08
PRK10677257 modA molybdate transporter periplasmic protein; Provisi 98.05
COG1464268 NlpA ABC-type metal ion transport system, periplasmic c 97.58
COG1732300 OpuBC Periplasmic glycine betaine/choline-binding (lipo 97.56
pfam03180236 Lipoprotein_9 NLPA lipoprotein. This family of bacteria 97.08
PRK09791302 putative DNA-binding transcriptional regulator; Provisi 97.05
PRK11151305 DNA-binding transcriptional regulator OxyR; Provisional 96.84
PRK12684313 transcriptional regulator CysB-like protein; Reviewed 96.84
PRK12679316 cbl transcriptional regulator Cbl; Reviewed 96.77
PRK12682309 transcriptional regulator CysB-like protein; Reviewed 96.18
PRK12680327 transcriptional regulator CysB-like protein; Reviewed 95.81
TIGR03414290 ABC_choline_bnd choline ABC transporter, periplasmic bi 95.72
PRK11074300 putative DNA-binding transcriptional regulator; Provisi 95.65
PRK04168336 hypothetical protein; Provisional 95.63
PRK11062296 nhaR transcriptional activator NhaR; Provisional 95.61
PRK10682370 putrescine transporter subunit: periplasmic-binding com 95.38
PRK09986278 DNA-binding transcriptional activator XapR; Provisional 94.38
COG4143336 TbpA ABC-type thiamine transport system, periplasmic co 94.2
PRK11205326 tbpA thiamine transporter substrate binding subunit; Pr 93.89
PRK11233305 nitrogen assimilation transcriptional regulator; Provis 92.99
TIGR03339279 phn_lysR aminoethylphosphonate catabolism associated Ly 92.74
KOG1053 1258 consensus 99.5
KOG4440 993 consensus 99.05
COG0715335 TauA ABC-type nitrate/sulfonate/bicarbonate transport s 98.64
COG1638332 DctP TRAP-type C4-dicarboxylate transport system, perip 97.78
TIGR01729304 taurine_ABC_bnd taurine ABC transporter, periplasmic bi 97.75
COG4588252 AcfC Accessory colonization factor AcfC, contains ABC-t 97.55
pfam04069256 OpuAC Substrate binding domain of ABC-type glycine beta 96.73
TIGR01256225 modA molybdate ABC transporter, periplasmic molybdate-b 95.31
COG1910223 Periplasmic molybdate-binding protein/domain [Inorganic 95.02
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 94.93
COG0687363 PotD Spermidine/putrescine-binding periplasmic protein 94.11
pfam00060270 Lig_chan Ligand-gated ion channel. This family includes 99.18
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmic sub 99.12
pfam03401274 Bug Tripartite tricarboxylate transporter family recept 97.31
pfam03480285 SBP_bac_7 Bacterial extracellular solute-binding protei 96.73
COG3181319 Uncharacterized protein conserved in bacteria [Function 95.99
TIGR00787267 dctP TRAP transporter solute receptor, DctP family; Int 94.28
PRK03537188 hypothetical protein; Provisional 92.16
pfam09084216 NMT1 NMT1/THI5 like. This family contains the NMT1 and 98.64
TIGR01728311 SsuA_fam ABC transporter, substrate-binding protein, al 95.93
COG2358321 Imp TRAP-type uncharacterized transport system, peripla 97.91
PRK11119332 proX glycine betaine transporter periplasmic subunit; P 94.5
COG2113302 ProX ABC-type proline/glycine betaine transport systems 92.67
CHL00180307 rbcR LysR transcriptional regulator; Provisional 97.07
pfam03466209 LysR_substrate LysR substrate binding domain. The struc 96.99
PRK11242292 DNA-binding transcriptional regulator CynR; Provisional 96.84
PRK12683308 transcriptional regulator CysB-like protein; Reviewed 96.79
PRK12681324 cysB transcriptional regulator CysB; Reviewed 96.16
PRK11013309 DNA-binding transcriptional regulator LysR; Provisional 93.42
PRK11716269 DNA-binding transcriptional regulator IlvY; Provisional 90.97
PRK09906296 DNA-binding transcriptional regulator HcaR; Provisional 90.74
COG4663363 FcbT1 TRAP-type mannitol/chloroaromatic compound transp 96.94
TIGR03061164 pip_yhgE_Nterm YhgE/Pip N-terminal domain. This family 94.33
COG1511 780 Predicted membrane protein [Function unknown] 92.7
PRK10341312 DNA-binding transcriptional activator TdcA; Provisional 96.01
TIGR00212312 hemC porphobilinogen deaminase; InterPro: IPR000860 Tet 92.34
PRK09508314 leuO leucine transcriptional activator; Reviewed 91.59
PRK01066234 porphobilinogen deaminase; Provisional 91.56
PRK09755 535 putative binding protein; Provisional 95.55
pfam1061365 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and gl 91.4
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein; InterPro: IPR005768 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein; InterPro: IPR014337 Members of this entry are the extracellular solute-binding proteins of ABC transporters and they closely resemble amino acid transporters Back     alignment and domain information
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>pfam00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PRK10859 putative transglycosylase; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1052 consensus Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>TIGR01098 3A0109s03R phosphonate ABC transporter, periplasmic phosphonate-binding protein; InterPro: IPR005770 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR02285 TIGR02285 conserved hypothetical protein; InterPro: IPR011972 Members of this family are found in several Proteobacteria, including Pseudomonas putida (strain KT2440), Bdellovibrio bacteriovorus HD100 (three members), Aeromonas hydrophila, and Chromobacterium violaceum ATCC 12472 Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>KOG1054 consensus Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional Back     alignment and domain information
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional Back     alignment and domain information
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4521 TauA ABC-type taurine transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>COG1464 NlpA ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1732 OpuBC Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam03180 Lipoprotein_9 NLPA lipoprotein Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>PRK12684 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12679 cbl transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12680 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>TIGR03414 ABC_choline_bnd choline ABC transporter, periplasmic binding protein Back     alignment and domain information
>PRK11074 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK04168 hypothetical protein; Provisional Back     alignment and domain information
>PRK11062 nhaR transcriptional activator NhaR; Provisional Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09986 DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>KOG1053 consensus Back     alignment and domain information
>KOG4440 consensus Back     alignment and domain information
>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1638 DctP TRAP-type C4-dicarboxylate transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein; InterPro: IPR010068 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4588 AcfC Accessory colonization factor AcfC, contains ABC-type periplasmic domain [General function prediction only] Back     alignment and domain information
>pfam04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system Back     alignment and domain information
>TIGR01256 modA molybdate ABC transporter, periplasmic molybdate-binding protein; InterPro: IPR005950 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00060 Lig_chan Ligand-gated ion channel Back     alignment and domain information
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>pfam03401 Bug Tripartite tricarboxylate transporter family receptor Back     alignment and domain information
>pfam03480 SBP_bac_7 Bacterial extracellular solute-binding protein, family 7 Back     alignment and domain information
>COG3181 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00787 dctP TRAP transporter solute receptor, DctP family; InterPro: IPR004682 TRAP-T family proteins generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-positive bacteria and archaea Back     alignment and domain information
>PRK03537 hypothetical protein; Provisional Back     alignment and domain information
>pfam09084 NMT1 NMT1/THI5 like Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family; InterPro: IPR010067 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG2358 Imp TRAP-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>PRK11119 proX glycine betaine transporter periplasmic subunit; Provisional Back     alignment and domain information
>COG2113 ProX ABC-type proline/glycine betaine transport systems, periplasmic components [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00180 rbcR LysR transcriptional regulator; Provisional Back     alignment and domain information
>pfam03466 LysR_substrate LysR substrate binding domain Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>PRK12683 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12681 cysB transcriptional regulator CysB; Reviewed Back     alignment and domain information
>PRK11013 DNA-binding transcriptional regulator LysR; Provisional Back     alignment and domain information
>PRK11716 DNA-binding transcriptional regulator IlvY; Provisional Back     alignment and domain information
>PRK09906 DNA-binding transcriptional regulator HcaR; Provisional Back     alignment and domain information
>COG4663 FcbT1 TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03061 pip_yhgE_Nterm YhgE/Pip N-terminal domain Back     alignment and domain information
>COG1511 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>TIGR00212 hemC porphobilinogen deaminase; InterPro: IPR000860 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway Back     alignment and domain information
>PRK09508 leuO leucine transcriptional activator; Reviewed Back     alignment and domain information
>PRK01066 porphobilinogen deaminase; Provisional Back     alignment and domain information
>PRK09755 putative binding protein; Provisional Back     alignment and domain information
>pfam10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target274 putative amino acid-binding periplasmic ABC transporter
1ggg_A226 Glutamine Binding Protein Open Ligand-Free Structur 8e-24
1hsl_A238 Refined 1.89 Angstroms Structure Of The Histidine-B 2e-23
1laf_E238 Structural Bases For Multiple Ligand Specificity Of 3e-22
1lst_A239 Three-Dimensional Structures Of The Periplasmic Lys 3e-22
2y7i_A229 Tbc Length = 229 4e-20
2q2a_B243 Crystal Structures Of The Arginine-, Lysine-, Histi 9e-20
2pvu_A239 Crystal Structures Of The Arginine-, Lysine-, Histi 1e-19
2q2c_B234 Crystal Structures Of The Arginine-, Lysine-, Histi 3e-19
2q2c_C233 Crystal Structures Of The Arginine-, Lysine-, Histi 3e-19
3hv1_A268 Crystal Structure Of A Polar Amino Acid Abc Uptake 7e-19
3k4u_A245 Crystal Structure Of Putative Binding Component Of 5e-18
3i6v_A232 Crystal Structure Of A Periplasmic HisGLUGLNARGOPIN 5e-18
3h7m_A234 Crystal Structure Of A Histidine Kinase Sensor Doma 8e-18
3del_B242 The Structure Of Ct381, The Arginine Binding Protei 8e-16
2vha_A287 Debp Length = 287 4e-13
1xt8_A292 Crystal Structure Of Cysteine-Binding Protein From 3e-12
2iee_A271 Crystal Structure Of Yckb_bacsu From Bacillus Subti 4e-12
3g41_A246 The Structure Of Cpn0482, The Arginine Binding Prot 1e-11
3n26_A246 Cpn0482 : The Arginine Binding Protein From The Per 2e-11
2ia4_B280 Crystal Structure Of Novel Amino Acid Binding Prote 6e-11
2o1m_A258 Crystal Structure Of The Probable Amino-Acid Abc Tr 8e-11
2ia4_A279 Crystal Structure Of Novel Amino Acid Binding Prote 1e-10
2pyy_A228 Crystal Structure Of The Glur0 Ligand-Binding Core 1e-10
3kzg_A237 Crystal Structure Of An Arginine 3rd Transport Syst 1e-09
2pyy_B218 Crystal Structure Of The Glur0 Ligand-Binding Core 2e-09
2v25_B232 Structure Of The Campylobacter Jejuni Antigen Peb1a 8e-09
3kbr_A239 The Crystal Structure Of Cyclohexadienyl Dehydratas 4e-07
2q88_A257 Crystal Structure Of Ehub In Complex With Ectoine L 6e-07
>gi|1943541|pdb|1GGG|A Chain A, Glutamine Binding Protein Open Ligand-Free Structure Length = 226 Back     alignment and structure
 Score =  115 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 62/228 (27%), Positives = 95/228 (41%), Gaps = 8/228 (3%)

Query: 39  DQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITG- 97
               L V TD  + P  F   D      GFD+DL   +A  L L  E      SG+I   
Sbjct: 1   ADKKLVVATDTAFVPFEFKQGDL---YVGFDVDLWAAIAKELKLDYELKPMDFSGIIPAL 57

Query: 98  LDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILG 157
              N    L  + IT ER+K  DFS  Y    +L++V+++  D++S KDL  K VA   G
Sbjct: 58  QTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSG 117

Query: 158 TDLSRFAKELKSHL--VFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKI 215
           T    +AK            N + +   L + R DA +        F++   +    FK 
Sbjct: 118 TGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNG--QFKA 175

Query: 216 ADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDK 263
                +         KG+++L   +N  L  +  +GTY +I+ ++F  
Sbjct: 176 VGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGT 223


>gi|576158|pdb|1HSL|A Chain A, Refined 1.89 Angstroms Structure Of The Histidine-Binding Protein Complexed With Histidine And Its Relationship With Many Other Active Transport(Slash)chemosensory Receptors Length = 238 Back     alignment and structure
>gi|1065303|pdb|1LAF|E Chain E, Structural Bases For Multiple Ligand Specificity Of The Periplasmic Lysine-, Arginine-, Ornithine-Binding Protein Length = 238 Back     alignment and structure
>gi|157831886|pdb|1LST|A Chain A, Three-Dimensional Structures Of The Periplasmic Lysine-, Arginine-, Ornithine-Binding Protein With And Without A Ligand Length = 239 Back     alignment and structure
>gi|332639431|pdb|2Y7I|A Chain A, Tbc Length = 229 Back     alignment and structure
>gi|241913538|pdb|3HV1|A Chain A, Crystal Structure Of A Polar Amino Acid Abc Uptake Transporter Substrate Binding Protein From Streptococcus Thermophilus Length = 268 Back     alignment and structure
>gi|262368132|pdb|3K4U|A Chain A, Crystal Structure Of Putative Binding Component Of Abc Transporter From Wolinella Succinogenes Dsm 1740 Complexed With Lysine Length = 245 Back     alignment and structure
>gi|254575078|pdb|3I6V|A Chain A, Crystal Structure Of A Periplasmic HisGLUGLNARGOPINE Family-Binding Protein From Silicibacter Pomeroyi In Complex With Lysine Length = 232 Back     alignment and structure
>gi|242556607|pdb|3H7M|A Chain A, Crystal Structure Of A Histidine Kinase Sensor Domain With Similarity To Periplasmic Binding Proteins Length = 234 Back     alignment and structure
>gi|240104308|pdb|3DEL|B Chain B, The Structure Of Ct381, The Arginine Binding Protein From The Periplasm Chlamydia Trachomatis Length = 242 Back     alignment and structure
>gi|193885219|pdb|2VHA|A Chain A, Debp Length = 287 Back     alignment and structure
>gi|75765505|pdb|1XT8|A Chain A, Crystal Structure Of Cysteine-Binding Protein From Campylobacter Jejuni At 2.0 A Resolution Length = 292 Back     alignment and structure
>gi|116668123|pdb|2IEE|A Chain A, Crystal Structure Of Yckb_bacsu From Bacillus Subtilis. Northeast Structural Genomics Consortium Target Sr574. Length = 271 Back     alignment and structure
>gi|298508712|pdb|3N26|A Chain A, Cpn0482 : The Arginine Binding Protein From The Periplasm Of Chlamydia Pneumoniae Length = 246 Back     alignment and structure
>gi|122921285|pdb|2O1M|A Chain A, Crystal Structure Of The Probable Amino-Acid Abc Transporter Extracellular-Binding Protein Ytmk From Bacillus Subtilis. Northeast Structural Genomics Consortium Target Sr572 Length = 258 Back     alignment and structure
>gi|166007117|pdb|2PYY|A Chain A, Crystal Structure Of The Glur0 Ligand-Binding Core From Nostoc Punctiforme In Complex With (L)-Glutamate Length = 228 Back     alignment and structure
>gi|281501012|pdb|3KZG|A Chain A, Crystal Structure Of An Arginine 3rd Transport System Periplasmic Binding Protein From Legionella Pneumophila Length = 237 Back     alignment and structure
>gi|266618825|pdb|3KBR|A Chain A, The Crystal Structure Of Cyclohexadienyl Dehydratase Precursor From Pseudomonas Aeruginosa Pa01 Length = 239 Back     alignment and structure
>gi|164414782|pdb|2Q88|A Chain A, Crystal Structure Of Ehub In Complex With Ectoine Length = 257 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target274 putative amino acid-binding periplasmic ABC transporter
3hv1_A268 Polar amino acid ABC uptake transporter substrate bindi 6e-36
1lst_A239 Lysine, arginine, ornithine-binding protein; amino-acid 4e-35
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding protei 4e-35
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sensor do 1e-33
3h7m_A234 Sensor protein; histidine kinase sensor domain, kinase, 8e-33
3kzg_A237 Arginine 3RD transport system periplasmic binding prote 2e-32
3g41_A246 Amino acid ABC transporter, periplasmic amino acid-bind 8e-31
1wdn_A226 GLNBP, glutamine binding protein; closed form, complex, 8e-30
1ii5_A233 Hypothetical protein SLR1257; membrane protein; HET: GL 2e-29
3del_B242 Arginine binding protein; alpha and beta protein (A/B), 2e-29
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand binding 2e-26
3k4u_A245 Binding component of ABC transporter; structural genomi 8e-25
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transport s 2e-23
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, S1S2, 1e-22
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; GLUR 1e-22
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate recep 8e-22
2iee_A271 ORF2, probable ABC transporter extracellular-binding pr 1e-21
2vha_A287 Periplasmic binding transport protein; periplasmic bind 8e-21
2o1m_A258 Probable amino-acid ABC transporter extracellular-bindi 8e-21
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane protein, 2e-19
1xt8_A292 Putative amino-acid transporter periplasmic solute-bind 5e-19
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic membra 1e-18
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane prot 3e-17
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMDA rec 1e-16
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginosa PA0 2e-16
2q88_A257 EHUB, putative ABC transporter amino acid-binding prote 4e-16
2v25_A259 Major cell-binding factor; antigen, adhesin, aspartate, 3e-10
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-bindin 0.001
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
 Score =  146 bits (368), Expect = 6e-36
 Identities = 52/233 (22%), Positives = 99/233 (42%), Gaps = 14/233 (6%)

Query: 43  LRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNR 102
           +++G D  + P  +   +  G   GFDIDL   V     + VE+         T L    
Sbjct: 23  IKIGFDATFVPMGYE--EKDGSYIGFDIDLANAVFKLYGIDVEWQAIDWDMKETELKNGT 80

Query: 103 YDVLVNV-AITPERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLS 161
            D++ N  ++T ER++  DF+ PY+ +  +LV +     I S   +  KT+    G+   
Sbjct: 81  IDLIWNGYSVTDERKQSADFTEPYMVNEQVLVTKKS-SGIDSVAGMAGKTLGAQAGSSGY 139

Query: 162 RFAKE---------LKSHLVFSHNFEQSLQLLLSKRTDATMIPDIPFFNFLERRPHDGNL 212
                             +V    F Q+L  L S R D  +I D  + N+   +    + 
Sbjct: 140 DAFNASPKILKDVVANQKVVQYSTFTQALIDLNSGRIDGLLI-DRVYANYYLEKSGVLDQ 198

Query: 213 FKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDKNI 265
           + +     +  + A   RK +  L + IN+    ++ +G ++KI +++F +++
Sbjct: 199 YNVMPAGYEGESFAVGARKVDKTLIKKINQGFETLYKNGEFQKISNKWFGEDV 251


>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding protein; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>1ii5_A Hypothetical protein SLR1257; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, thermophilic bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme pcc 73102} Length = 228 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.0A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, alternative splicing, calcium, cell junction, coiled coil, glycoprotein, ION transport; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solute-binding protein; ABC transport, cysteine uptake, spine, structural genomics; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2i0c_A* 3c31_A* 1txf_A* 3c32_A* 3c33_A* 3c34_A* 3c35_A* 3c36_A* 2wky_A* ... Length = 259 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* Length = 284 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginosa PA01,structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding protein; substrate-binding protein, compatible solues, osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Length = 324 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target274 putative amino acid-binding periplasmic ABC transporter
3hv1_A268 Polar amino acid ABC uptake transporter substrate bindi 100.0
3h7m_A234 Sensor protein; histidine kinase sensor domain, kinase, 100.0
3g41_A246 Amino acid ABC transporter, periplasmic amino acid-bind 100.0
2o1m_A258 Probable amino-acid ABC transporter extracellular-bindi 100.0
1xt8_A292 Putative amino-acid transporter periplasmic solute-bind 100.0
2vha_A287 Periplasmic binding transport protein; periplasmic bind 100.0
2iee_A271 ORF2, probable ABC transporter extracellular-binding pr 100.0
1wdn_A226 GLNBP, glutamine binding protein; closed form, complex, 100.0
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transport s 100.0
3del_B242 Arginine binding protein; alpha and beta protein (A/B), 100.0
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sensor do 100.0
3kzg_A237 Arginine 3RD transport system periplasmic binding prote 100.0
1lst_A239 Lysine, arginine, ornithine-binding protein; amino-acid 100.0
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding protei 100.0
1ii5_A233 Hypothetical protein SLR1257; membrane protein; HET: GL 100.0
2q88_A257 EHUB, putative ABC transporter amino acid-binding prote 100.0
2v25_A259 Major cell-binding factor; antigen, adhesin, aspartate, 100.0
3k4u_A245 Binding component of ABC transporter; structural genomi 100.0
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginosa PA0 100.0
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; GLUR 100.0
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand binding 100.0
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, S1S2, 99.98
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate recep 99.97
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic membra 99.97
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane prot 99.96
3kg2_A823 Glutamate receptor 2; ION channel, membrane protein, al 99.66
3n5l_A310 Binding protein component of ABC phosphonate TRAN; stru 99.26
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-bindin 99.02
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; tran 98.79
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine prote 98.71
3myu_A344 High affinity transport system protein P37; Mg289, CYPL 98.52
3gxa_A275 Outer membrane lipoprotein GNA1946; periplasmic, L-meth 98.26
1p99_A295 Hypothetical protein PG110; structural genomics, PSI, p 98.07
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; periplasmic 97.93
2zzv_A361 ABC transporter, solute-binding protein; periplasmic su 97.92
3hn0_A283 Nitrate transport protein; YP_001302749.1, structural g 97.88
2hzl_A365 Trap-T family sorbitol/mannitol transporter, periplasmi 97.76
3ir1_A245 Outer membrane lipoprotein GNA1946; D-methionine cultur 97.67
3fxb_A326 Trap dicarboxylate transporter, DCTP subunit; periplasm 97.66
3k2d_A237 ABC-type metal ION transport system, periplasmic; alpha 97.61
2g29_A 417 Nitrate transport protein NRTA; solute-binding protein, 97.34
2i49_A 429 Bicarbonate transporter; alpha-beta protein, C-clamp, A 96.55
2hxr_A238 HTH-type transcriptional regulator CYNR; CYNR transcrip 96.51
1zbm_A280 Hypothetical protein AF1704; alpha-beta protein, struct 96.27
2rin_A298 Putative glycine betaine-binding ABC transporter protei 96.23
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; OXYR 95.94
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional regulat 95.83
2hpg_A327 ABC transporter, periplasmic substrate-binding protein; 95.76
3oxn_A241 Putative transcriptional regulator, LYSR family; struct 95.63
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcription, t 95.53
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR-type 95.47
2qry_A330 Thiamine-binding periplasmic protein; thiamin binding p 92.39
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMDA rec 99.98
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane protein, 99.97
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, struct 99.35
2de3_A365 Dibenzothiophene desulfurization enzyme B; alpha-beta, 98.49
2pfy_A301 Putative exported protein; extracytoplasmic solute rece 97.67
2pfz_A301 Putative exported protein; extracytoplasmic solute rece 97.67
3b50_A310 Sialic acid-binding periplasmic protein SIAP; periplasm 97.52
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding prote 96.89
2nxo_A291 Hypothetical protein SCO4506; PFAM, DUF178, NYSGXRC, 10 96.71
2dvz_A314 BUGE, putative exported protein; periplamsic binding pr 96.66
2f5x_A312 BUGD; periplasmic binding protein, transport protein; 1 96.21
1atg_A231 MODA, periplasmic molybdate-binding protein; tungstate, 95.97
3l6g_A256 Betaine ABC transporter permease and substrate BI prote 95.39
2czl_A272 Hypothetical protein TTHA1568; conserved hypothetical p 94.44
1h3d_A299 ATP-phosphoribosyltransferase; hisitidine biosynthesis, 93.93
1amf_A233 Molybdate transport protein MODA; periplasmic, binding 91.07
3gzg_A253 Molybdate-binding periplasmic protein; permease; molybd 90.66
1us5_A314 Putative GLUR0 ligand binding core; receptor, membrane 97.96
2vpn_A316 Periplasmic substrate binding protein; ectoine, hydroxy 97.44
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, transp 96.88
2b4l_A268 Glycine betaine-binding protein; substrate-binding prot 91.82
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R family, c 96.23
2ql3_A209 Probable transcriptional regulator, LYSR family protein 95.49
1ixc_A294 CBNR, LYSR-type regulatory protein; long alpha helix co 94.84
3fzv_A306 Probable transcriptional regulator; LYSR, structural ge 94.63
3fd3_A208 Chromosome replication initiation inhibitor protein; st 91.36
2b6d_A345 Lactotransferrin; complex, drugs, lactoferrin; HET: NAG 94.1
2esn_A310 Probable transcriptional regulator; PA0477, APC5828,tra 92.7
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR family 92.32
2h9b_A312 HTH-type transcriptional regulator BENM; LTTR, transcri 91.7
1twy_A290 ABC transporter, periplasmic substrate-binding protein; 91.13
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
Probab=100.00  E-value=1.3e-42  Score=281.82  Aligned_cols=233  Identities=22%  Similarity=0.336  Sum_probs=204.2

Q ss_pred             HHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEEEEEEHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCCCCH-HCCCC
Q ss_conf             88788589589996289987248704699848898852167899762998555668988988643103221100-00367
Q gi|254781112|r   34 PFRTEDQSALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLV-NVAIT  112 (274)
Q Consensus        34 ~~~~~~~~~l~v~~~~~~pP~~~~~~d~~g~~~G~~~dl~~~i~~~lg~~~~~~~~~~~~~~~~l~~g~~D~~~-~~~~t  112 (274)
                      ...++++++||||++.+||||+|.  |++|++.||++|+++++++++|++++|+++||.+++.+|++|++|+++ ++..+
T Consensus        14 ~~~~~~~~~l~vg~~~~~pP~~~~--~~~g~~~G~~vdl~~~i~~~lg~~v~~~~~~~~~~~~~l~~g~~Di~~~~~~~~   91 (268)
T 3hv1_A           14 WQTYTKEKKIKIGFDATFVPMGYE--EKDGSYIGFDIDLANAVFKLYGIDVEWQAIDWDMKETELKNGTIDLIWNGYSVT   91 (268)
T ss_dssp             HHHHHHHTEEEEEECTEETTTEEE--CTTSCEECHHHHHHHHHHHTTTCEEEEEECCGGGHHHHHHHTSCSEECSSCBCC
T ss_pred             HHHHHCCCEEEEEECCCCCCCEEE--CCCCCEEEEHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             999860997999987898895589--999988872999999999996996575158889999999869976002326678


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCHHHHHHHC---------CCCCCEEECCHHHHHHH
Q ss_conf             567542002333222222222111222211111233432023101012233201---------34542133685577775
Q gi|254781112|r  113 PERQKKYDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKE---------LKSHLVFSHNFEQSLQL  183 (274)
Q Consensus       113 ~eR~~~~~fs~p~~~~~~~~~~~~~~~~~~~~~dL~g~~V~~~~g~~~~~~l~~---------~~~~~~~~~~~~~~~~~  183 (274)
                      ++|+..+.||.||+....++++|+++ .+++++||+|++||+..|+.+...+..         .+.+++.+.+..+++.+
T Consensus        92 ~~r~~~~~~s~py~~~~~~~v~~~~~-~~~~~~dl~~~~i~v~~gs~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~l~~  170 (268)
T 3hv1_A           92 DERKQSADFTEPYMVNEQVLVTKKSS-GIDSVAGMAGKTLGAQAGSSGYDAFNASPKILKDVVANQKVVQYSTFTQALID  170 (268)
T ss_dssp             HHHHTTCEECCCCEEECEEEEEEGGG-CCCSSGGGTTCCEEEETTCHHHHHHHHCTTTTTTTSGGGCEEEESSHHHHHHH
T ss_pred             HHHHHCEEECCCCCCCCEEEEEECCC-CCCCHHHHCCCCEEEECCCHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHH
T ss_conf             54441156321213564368986899-99997895798238866850999999866555431667324403999999999


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHCCCCCCCEEECCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHCCHHHHHHHHHCCC
Q ss_conf             54432100366558999999845876673262367768770799981899899999999999999798599999876788
Q gi|254781112|r  184 LLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSINEILCAIHLDGTYKKIFDRYFDK  263 (274)
Q Consensus       184 l~~grvD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~L~~~in~~l~~l~~~G~~~~I~~kw~g~  263 (274)
                      |.+||+|+++.+...+.+++++.+.... ..+.+......+++++++|++++|++.||++|.+|++||++++|++||||+
T Consensus       171 L~~grvD~~i~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~k~~~~L~~~in~~l~~l~~~G~~~~I~~kw~g~  249 (268)
T 3hv1_A          171 LNSGRIDGLLIDRVYANYYLEKSGVLDQ-YNVMPAGYEGESFAVGARKVDKTLIKKINQGFETLYKNGEFQKISNKWFGE  249 (268)
T ss_dssp             HHHTSCSEEEEEHHHHHHHHHHTTCGGG-EEEEECSSCCEEECCEECTTCHHHHHHHHHHHHHHHHHTHHHHHHHHHHSS
T ss_pred             HHCCCEEEEEECHHHHHHHHHHCCCCCC-EEECCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCHHHHHHHHHCCC
T ss_conf             9769757999438999999985898883-033377777743899981899999999999999999787999999997789


Q ss_pred             CCCCCCC
Q ss_conf             8775689
Q gi|254781112|r  264 NIISSVP  270 (274)
Q Consensus       264 d~~~~~~  270 (274)
                      |+....+
T Consensus       250 d~~~~~~  256 (268)
T 3hv1_A          250 DVATDQV  256 (268)
T ss_dssp             CCCCTTT
T ss_pred             CCCHHHC
T ss_conf             9993443



>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solute-binding protein; ABC transport, cysteine uptake, spine, structural genomics; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, thermophilic bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure