254781118

254781118

lysyl-tRNA synthetase

GeneID in NCBI database:8210143Locus tag:CLIBASIA_05100
Protein GI in NCBI database:254781118Protein Accession:YP_003065531.1
Gene range:+(1120506, 1122014)Protein Length:502aa
Gene description:lysyl-tRNA synthetase
COG prediction:none
KEGG prediction:lysS; lysyl-tRNA synthetase (EC:6.1.1.6); K04567 lysyl-tRNA synthetase, class II [EC:6.1.1.6]
SEED prediction:Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Lys
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MNNTLTPESLSSNSIEVRSQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHLQNDEKSQDMITVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQVRRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDVEIRYRKRYLDIISNSDSKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNAPSIRDVILFPAQRVKNGSRKTE
ccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccEEEEEEEEEcccccccEEEEEcccEEEEEEEccccccHHHHHHHHccccccEEEEEEEEEEcccccEEEEEEEEEEEEcccccccccccccccHHHHccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccEEEccccccccccEEcccccccccEEEccccHHHHHHHHHccccccEEEEEEEEcccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccEEEEccccccccccccccccccEEEEEEEEEccEEEccccHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccEEccHHHHHHHHcccccHHEEEccccccccccccccc
ccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccHHHHcccEEEEEEHEEEccccccEEEEEccccEEEEEEEcccccHHHHHHHHHcccccEEEEEEEEEEccccEEEEEHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEccccccEEcHHHHHHHcccccHcccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccEEEccccEEcHccccccccccccccEEEEEcEEEEEEccEEEEEEEEEcccHHHHHHHHHHccccHHHHHHHHHHHcEccccEEEEEEEHHHHHHHHcccccHHHcccccccccccccHccc
mnntltpeslssnsiEVRSQKLNMLRKSLAEvypahfhrditNAEVREKYSHLQNDEKSQDMITVAGRVyssrnsgmfmdihdasgkiqifthkdtadqdsqNLLSMIDIGDIIGITGQvrrtkrgeltVNAQKIIMLSKAlnsipetyyglsdvEIRYRKRYLdiisnsdsKIRFQQRSLLISQIRHFMekkgfmevetpilqpiyggatadpfkthhNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNfrnegvssrhnpeftMIEAYWAYTDYRDMMKLVEDLCHNLAKtlhgttdipfgekvisfkapFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIeknivnpthitdfpkdisPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHqrgehtildedfldamtygmppasglglgIDRLIMLLtnapsirdvilfpaqrvkngsrkte
mnntltpeslssnsieVRSQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHlqndeksqdmiTVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGitgqvrrtkrgeLTVNAQKIIMlskalnsipetyyglsdveIRYRKRYLDiisnsdskirfQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNFrnegvssrhnpeftMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNApsirdvilfpaqrvkngsrkte
MNNTLTPESLSSNSIEVRSQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHLQNDEKSQDMITVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMidigdiigiTGQVRRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDVEIRYRKRYLDIISNSDSKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNAPSIRDVILFPAQRVKNGSRKTE
******************SQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHLQNDEKSQDMITVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQVRRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDVEIRYRKRYLDIISNSDSKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRME**V******GEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNAPSIRDVILF*************
************NSIEVRSQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHLQNDEKSQDMITVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQVRRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDVEIRYRKRYLDIISNSDSKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRM**********GEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNAPSIRDVILFPAQR*********
*******ESLSSNSIEVRSQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHLQNDEKSQDMITVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQVRRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDVEIRYRKRYLDIISNSDSKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNAPSIRDVILFPAQ**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNTLTPESLSSNSIEVRSQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHLQNDEKSQDMITVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQVRRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDVEIRYRKRYLDIISNSDSKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNAPSIRDVILFPAQRVKNGSRKTE
MNNTLTPESLSSNSIEVRSQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHLQNDEKSQDMITVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQVRRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDVEIRYRKRYLDIISNSDSKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNAPSIRDVILFPAQRVKNGSRKTE
MNNTLTPESLSSNSIEVRSQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHLQNDEKSQDMITVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQVRRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDVEIRYRKRYLDIISNSDSKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALWGEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNAPSIRDVILFPAQRVKNGSRKTE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target502 lysyl-tRNA synthetase [Candidatus Liberibacter asiaticu
254781066355 putative lysyl-tRNA synthetase protein [Candidatus 2e-36
254780419 622 aspartyl-tRNA synthetase [Candidatus Liberibacter 1e-09
254780419622 aspartyl-tRNA synthetase [Candidatus Liberibacter 2e-07
>gi|254781066|ref|YP_003065479.1| putative lysyl-tRNA synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 355 Back     alignment
 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 107/332 (32%), Positives = 168/332 (50%), Gaps = 28/332 (8%)

Query: 178 QRSLLISQIRHFMEKKGFMEVETPILQPIYGGAT-ADPFKTH---HNILKADMYLRIAPE 233
           +R+++ S +R +  +  F+E+++  LQ   G  T    F T     + ++  +YL+ +PE
Sbjct: 24  KRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPE 83

Query: 234 LYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHN 293
              K++L +G  +++F     +RN      H PEFTM+E Y A+  Y  +MK   ++   
Sbjct: 84  FSCKKLLAAG-EEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRC 142

Query: 294 LAK-------TLHGTTDIPFGE-KVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEAR- 344
            A+       +       PF E + I+    FA  + + L    T LD      DQ  R 
Sbjct: 143 AAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDL---GTTLD----NPDQPDRH 195

Query: 345 ---VAAQSIGITVENDALWGEVMMTIFEEKIEKNI-VNPTHITD-FPKDISPFAKEVAGE 399
              + AQ  GI V +D  W ++   I  EKIE N+ +N   I D +P   S  A     +
Sbjct: 196 LLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPAD 255

Query: 400 KRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHQ-RGEHTILDEDFLDAMTY 458
            R  +RFE Y    E+CNA  EL DP+EQR R E+++++  +   E   +DEDFL  +T 
Sbjct: 256 PRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLT- 314

Query: 459 GMPPASGLGLGIDRLIMLLTNAPSIRDVILFP 490
            MP +SG+ +G DRL+ML+T A +I +VI  P
Sbjct: 315 EMPQSSGIAMGFDRLVMLVTGANNINEVIWTP 346

>gi|254780419|ref|YP_003064832.1| aspartyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 622 Back     alignment
 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 115/244 (47%), Gaps = 22/244 (9%)

Query: 62  MITVAGRVYSSRNSG--MFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQ 119
            + ++G V+  R  G  +F+DI D  G  Q+  + D+A      +   +    ++ I G 
Sbjct: 20  FVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVANPDSA---CFEIAKSVRSEWVLCIDGL 76

Query: 120 VRRTKR---------GELTVNAQKIIMLSKALNSIPETYYGLSDV--EIRYRKRYLDIIS 168
           V              G++ ++AQKI +LS A   +P   +G  +    IR++ R+LD+  
Sbjct: 77  VMSRSAETINANIITGQIELSAQKIEILSVA-EELPLPVFGEREYPESIRFKYRFLDLRR 135

Query: 169 NSDSKIRFQQRSLLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMY- 227
           ++  K    +R+ +I+ +R  M  + F+E  TPIL         D F     + +   Y 
Sbjct: 136 DTLHK-NIVKRTRIINSMRCRMIAENFIECSTPILTASSPEGARD-FLVPSRVNQGSFYA 193

Query: 228 LRIAPELYLKRVLISGLTDQVFELNRNFRNEGVSSRHNP-EFTMIEAYWAYTDYRDMMKL 286
           L  AP+ Y + ++ SG  D+ F++   FR+E   S   P EF  ++   ++ +  D++  
Sbjct: 194 LPQAPQQYKQLLMASGF-DRYFQIAPCFRDEDPRSDRLPGEFYQLDMEMSFVEQDDILNT 252

Query: 287 VEDL 290
           +E++
Sbjct: 253 MENV 256

>gi|254780419|ref|YP_003064832.1| aspartyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 622 Back     alignment
 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 13/91 (14%)

Query: 405 RFETYCNGWEIC-----NAFSELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYG 459
           +++  CNG+EI      N  SE+       + + ++V ++   G +         A   G
Sbjct: 481 QYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEVVENRFGGLYR--------AFQCG 532

Query: 460 MPPASGLGLGIDRLIMLLTNAPSIRDVILFP 490
           MPP  G+  GIDR++MLL  A ++R+V LFP
Sbjct: 533 MPPHGGIAAGIDRIVMLLLGAKNVREVSLFP 563

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target502 lysyl-tRNA synthetase [Candidatus Liberibacter asiaticu
315122583496 lysyl-tRNA synthetase [Candidatus Liberibacter solanace 1 0.0
150397998498 lysyl-tRNA synthetase [Sinorhizobium medicae WSM419] Le 1 0.0
15966657498 lysyl-tRNA synthetase protein [Sinorhizobium meliloti 1 1 0.0
116253922498 lysyl-tRNA synthetase [Rhizobium leguminosarum bv. vici 1 0.0
209550996497 lysyl-tRNA synthetase [Rhizobium leguminosarum bv. trif 1 0.0
222087177498 lysyl-tRNA synthetase protein [Agrobacterium radiobacte 1 0.0
190893501498 lysyl-tRNA synthetase [Rhizobium etli CIAT 652] Length 1 0.0
241206404498 lysyl-tRNA synthetase [Rhizobium leguminosarum bv. trif 1 0.0
86359247498 lysyl-tRNA synthetase protein [Rhizobium etli CFN 42] L 1 0.0
3582260498 lysyl-tRNA synthetase [Sinorhizobium meliloti] Length = 1 0.0
>gi|315122583|ref|YP_004063072.1| lysyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 496 Back     alignment and organism information
 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/495 (87%), Positives = 466/495 (94%)

Query: 1   MNNTLTPESLSSNSIEVRSQKLNMLRKSLAEVYPAHFHRDITNAEVREKYSHLQNDEKSQ 60
           MNN+  PESLSS+SIEVRSQKLN+LR+SL EVYPAHFHRD+TNAE+ EKYSHLQ+DEKS+
Sbjct: 1   MNNSTLPESLSSHSIEVRSQKLNILRQSLEEVYPAHFHRDLTNAELSEKYSHLQDDEKSE 60

Query: 61  DMITVAGRVYSSRNSGMFMDIHDASGKIQIFTHKDTADQDSQNLLSMIDIGDIIGITGQV 120
           D++T+AGRVYSSRNSGMFMD+HDASGKIQIFTHK+T DQDSQNLL MID+GDIIG+TGQV
Sbjct: 61  DIVTIAGRVYSSRNSGMFMDLHDASGKIQIFTHKNTTDQDSQNLLPMIDLGDIIGVTGQV 120

Query: 121 RRTKRGELTVNAQKIIMLSKALNSIPETYYGLSDVEIRYRKRYLDIISNSDSKIRFQQRS 180
           RRTKRGELTVN+Q I ML+KALNSIPETYYGLSD+E RYRKRYLDIISN DSK+RFQQRS
Sbjct: 121 RRTKRGELTVNSQTITMLTKALNSIPETYYGLSDIETRYRKRYLDIISNPDSKLRFQQRS 180

Query: 181 LLISQIRHFMEKKGFMEVETPILQPIYGGATADPFKTHHNILKADMYLRIAPELYLKRVL 240
            +ISQIRHFME  GFMEVETPILQPIYGGATADPF THHNILKADMYLRIAPELYLKRVL
Sbjct: 181 RIISQIRHFMENNGFMEVETPILQPIYGGATADPFITHHNILKADMYLRIAPELYLKRVL 240

Query: 241 ISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHNLAKTLHG 300
           +SGLTDQVFELNRNFRNEG+SSRHNPEFTMIEAYWAYTDYRDMMKLVEDL HNL  +L+G
Sbjct: 241 VSGLTDQVFELNRNFRNEGISSRHNPEFTMIEAYWAYTDYRDMMKLVEDLFHNLVISLYG 300

Query: 301 TTDIPFGEKVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEARVAAQSIGITVENDALW 360
            TDIPFG+KVISFK PFACKSM QLVKEATG+DFMLLKSDQEARVAAQSIGI VE DA+W
Sbjct: 301 KTDIPFGKKVISFKKPFACKSMPQLVKEATGIDFMLLKSDQEARVAAQSIGIEVEEDAIW 360

Query: 361 GEVMMTIFEEKIEKNIVNPTHITDFPKDISPFAKEVAGEKRLVERFETYCNGWEICNAFS 420
           GEVMM +FEEKIEKNI+NP HITDFPKDISPFAKEV GE RLVERFETYCNGWEICNAFS
Sbjct: 361 GEVMMNLFEEKIEKNILNPMHITDFPKDISPFAKEVVGESRLVERFETYCNGWEICNAFS 420

Query: 421 ELNDPVEQRIRMEQQVEQSHQRGEHTILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNA 480
           ELNDP+EQRIRME+Q++QSH+RGE  ILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNA
Sbjct: 421 ELNDPIEQRIRMEKQLKQSHKRGEKIILDEDFLDAMTYGMPPASGLGLGIDRLIMLLTNA 480

Query: 481 PSIRDVILFPAQRVK 495
           PSIRDVILFP QR+K
Sbjct: 481 PSIRDVILFPVQRLK 495


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397998|ref|YP_001328465.1| lysyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 498 Back     alignment and organism information
>gi|15966657|ref|NP_387010.1| lysyl-tRNA synthetase protein [Sinorhizobium meliloti 1021] Length = 498 Back     alignment and organism information
>gi|116253922|ref|YP_769760.1| lysyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 498 Back     alignment and organism information
>gi|209550996|ref|YP_002282913.1| lysyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 497 Back     alignment and organism information
>gi|222087177|ref|YP_002545712.1| lysyl-tRNA synthetase protein [Agrobacterium radiobacter K84] Length = 498 Back     alignment and organism information
>gi|190893501|ref|YP_001980043.1| lysyl-tRNA synthetase [Rhizobium etli CIAT 652] Length = 498 Back     alignment and organism information
>gi|241206404|ref|YP_002977500.1| lysyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 498 Back     alignment and organism information
>gi|86359247|ref|YP_471139.1| lysyl-tRNA synthetase protein [Rhizobium etli CFN 42] Length = 498 Back     alignment and organism information
>gi|3582260|gb|AAC35210.1| lysyl-tRNA synthetase [Sinorhizobium meliloti] Length = 498 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target502 lysyl-tRNA synthetase [Candidatus Liberibacter asiaticu
PRK00484491 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed 0.0
PLN02502553 PLN02502, PLN02502, lysyl-tRNA synthetase 1e-155
TIGR00499496 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic 1e-155
KOG1885560 KOG1885, KOG1885, KOG1885, Lysyl-tRNA synthetase (class 1e-128
PRK029831094 PRK02983, lysS, lysyl-tRNA synthetase; Provisional 1e-119
PRK12445505 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed 1e-115
PTZ00417585 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional 7e-83
PTZ00385659 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional 3e-78
COG1190502 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Transl 1e-175
cd00775329 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class 1e-124
pfam00152341 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K 1e-92
TIGR00462304 TIGR00462, genX, lysyl-tRNA synthetase-like protein Gen 6e-68
cd00669269 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA syntheta 1e-64
COG2269322 COG2269, COG2269, Truncated, possibly inactive, lysyl-t 4e-52
PRK09350306 PRK09350, PRK09350, poxB regulator PoxA; Provisional 9e-52
cd00776322 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) 6e-31
cd00777280 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class 4e-26
PRK06462335 PRK06462, PRK06462, asparagine synthetase A; Reviewed 6e-14
PLN02850530 PLN02850, PLN02850, aspartate-tRNA ligase 1e-10
COG0017435 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [T 2e-45
TIGR00458428 TIGR00458, aspS_arch, aspartyl-tRNA synthetase, archaea 8e-31
PRK05159437 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional 7e-30
TIGR00457453 TIGR00457, asnS, asparaginyl-tRNA synthetase 4e-26
KOG0554446 KOG0554, KOG0554, KOG0554, Asparaginyl-tRNA synthetase 2e-20
PRK03932450 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated 2e-20
KOG0556533 KOG0556, KOG0556, KOG0556, Aspartyl-tRNA synthetase [Tr 8e-20
KOG0555545 KOG0555, KOG0555, KOG0555, Asparaginyl-tRNA synthetase 3e-18
PTZ00401550 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provision 7e-15
cd04322108 cd04322, LysRS_N, LysRS_N: N-terminal, anticodon recogn 6e-31
cd0410085 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-terminal 2e-10
pfam0133675 pfam01336, tRNA_anti, OB-fold nucleic acid binding doma 9e-10
cd04317135 cd04317, EcAspRS_like_N, EcAspRS_like_N: N-terminal, an 3e-06
cd04316108 cd04316, ND_PkAspRS_like_N, ND_PkAspRS_like_N: N-termin 0.001
COG0173 585 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, r 1e-20
TIGR00459 583 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacteri 2e-20
KOG2411 628 KOG2411, KOG2411, KOG2411, Aspartyl-tRNA synthetase, mi 1e-17
PLN02903 652 PLN02903, PLN02903, aminoacyl-tRNA ligase 4e-16
PRK12820 706 PRK12820, PRK12820, bifunctional aspartyl-tRNA syntheta 4e-12
PRK00476 588 PRK00476, aspS, aspartyl-tRNA synthetase; Validated 1e-14
PRK00476588 PRK00476, aspS, aspartyl-tRNA synthetase; Validated 4e-14
PLN02903652 PLN02903, PLN02903, aminoacyl-tRNA ligase 4e-10
PRK12820 706 PRK12820, PRK12820, bifunctional aspartyl-tRNA syntheta 6e-07
COG0173585 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, r 5e-14
TIGR00459583 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacteri 8e-14
KOG2411628 KOG2411, KOG2411, KOG2411, Aspartyl-tRNA synthetase, mi 9e-11
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA amino-a 4e-13
cd00496218 cd00496, PheRS_alpha_core, Phenylalanyl-tRNA synthetase 6e-04
PLN02603565 PLN02603, PLN02603, asparaginyl-tRNA synthetase 2e-09
PLN02532633 PLN02532, PLN02532, asparagine-tRNA synthetase 4e-09
PTZ00425586 PTZ00425, PTZ00425, asparagine-tRNA ligase; Provisional 3e-08
PLN02221572 PLN02221, PLN02221, asparaginyl-tRNA synthetase 2e-07
PRK09537417 PRK09537, pylS, pyrolysyl-tRNA synthetase; Reviewed 0.001
>gnl|CDD|179044 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178118 PLN02502, PLN02502, lysyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|129590 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>gnl|CDD|37096 KOG1885, KOG1885, KOG1885, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179519 PRK02983, lysS, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|171504 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173607 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional Back     alignment and domain information
>gnl|CDD|185588 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|31383 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29820 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>gnl|CDD|143920 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K and N) Back     alignment and domain information
>gnl|CDD|161889 TIGR00462, genX, lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>gnl|CDD|58337 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|32450 COG2269, COG2269, Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181791 PRK09350, PRK09350, poxB regulator PoxA; Provisional Back     alignment and domain information
>gnl|CDD|29821 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>gnl|CDD|73228 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>gnl|CDD|180575 PRK06462, PRK06462, asparagine synthetase A; Reviewed Back     alignment and domain information
>gnl|CDD|178442 PLN02850, PLN02850, aspartate-tRNA ligase Back     alignment and domain information
>gnl|CDD|30367 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129550 TIGR00458, aspS_arch, aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>gnl|CDD|179948 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|161887 TIGR00457, asnS, asparaginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|35774 KOG0554, KOG0554, KOG0554, Asparaginyl-tRNA synthetase (mitochondrial) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179678 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|35776 KOG0556, KOG0556, KOG0556, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35775 KOG0555, KOG0555, KOG0555, Asparaginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173592 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|58592 cd04322, LysRS_N, LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>gnl|CDD|58585 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>gnl|CDD|144799 pfam01336, tRNA_anti, OB-fold nucleic acid binding domain Back     alignment and domain information
>gnl|CDD|58587 cd04317, EcAspRS_like_N, EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>gnl|CDD|58586 cd04316, ND_PkAspRS_like_N, ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>gnl|CDD|30522 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129551 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>gnl|CDD|37622 KOG2411, KOG2411, KOG2411, Aspartyl-tRNA synthetase, mitochondrial [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178491 PLN02903, PLN02903, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|105955 PRK12820, PRK12820, bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>gnl|CDD|179042 PRK00476, aspS, aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|179042 PRK00476, aspS, aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|178491 PLN02903, PLN02903, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|105955 PRK12820, PRK12820, bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>gnl|CDD|30522 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129551 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>gnl|CDD|37622 KOG2411, KOG2411, KOG2411, Aspartyl-tRNA synthetase, mitochondrial [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29813 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|29807 cd00496, PheRS_alpha_core, Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>gnl|CDD|178213 PLN02603, PLN02603, asparaginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178147 PLN02532, PLN02532, asparagine-tRNA synthetase Back     alignment and domain information
>gnl|CDD|185610 PTZ00425, PTZ00425, asparagine-tRNA ligase; Provisional Back     alignment and domain information
>gnl|CDD|177867 PLN02221, PLN02221, asparaginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|181936 PRK09537, pylS, pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 502 lysyl-tRNA synthetase [Candidatus Liberibacter asiaticu
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 100.0
PRK12445505 lysyl-tRNA synthetase; Reviewed 100.0
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 100.0
COG1190502 LysU Lysyl-tRNA synthetase (class II) [Translation, rib 100.0
KOG1885560 consensus 100.0
TIGR00499538 lysS_bact lysyl-tRNA synthetase; InterPro: IPR002313 Th 100.0
KOG0555545 consensus 100.0
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl 100.0
TIGR00459653 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 100.0
PRK00476587 aspS aspartyl-tRNA synthetase; Validated 100.0
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 100.0
COG0173585 AspS Aspartyl-tRNA synthetase [Translation, ribosomal s 100.0
PRK03932462 asnC asparaginyl-tRNA synthetase; Validated 100.0
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation 100.0
TIGR00457495 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 T 100.0
KOG2411628 consensus 100.0
TIGR00458466 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 100.0
KOG0556533 consensus 100.0
KOG0554446 consensus 100.0
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II core do 100.0
pfam00152341 tRNA-synt_2 tRNA synthetases class II (D, K and N). 100.0
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II c 100.0
PRK09350325 lysyl-tRNA synthetase; Provisional 100.0
PRK06462332 asparagine synthetase A; Reviewed 100.0
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class I 100.0
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II core do 100.0
COG2269322 Truncated, possibly inactive, lysyl-tRNA synthetase (cl 100.0
TIGR00462330 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR0 100.0
PRK05425327 asparagine synthetase AsnA; Provisional 98.67
cd00645309 AsnA Asparagine synthetase (aspartate-ammonia ligase) ( 98.65
PTZ00213350 asparagine synthetase A; Provisional 98.33
COG2502330 AsnA Asparagine synthetase A [Amino acid transport and 98.1
cd04317135 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon re 99.95
cd04322108 LysRS_N LysRS_N: N-terminal, anticodon recognition doma 99.95
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, antico 99.86
cd04319103 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon re 99.84
cd04320102 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recogn 99.69
cd0410085 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodo 99.63
cd0432384 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, antico 99.61
cd0432186 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, antico 99.51
cd0431882 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon re 99.36
pfam0133675 tRNA_anti OB-fold nucleic acid binding domain. This fam 98.52
COG1107715 Archaea-specific RecJ-like exonuclease, contains DnaJ-t 96.47
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corr 96.27
cd0448392 hOBFC1_like hOBFC1_like: A subfamily of OB folds simila 95.81
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds 95.75
cd0447895 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds correspo 95.36
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds correspondin 95.21
cd0448291 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacteri 95.04
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds co 94.46
COG5235258 RFA2 Single-stranded DNA-binding replication protein A 93.84
cd04479101 RPA3 RPA3: A subfamily of OB folds similar to human RPA 93.57
COG3111128 Periplasmic protein with OB-fold [Function unknown] 93.38
pfam04076126 BOF Bacterial OB fold (BOF) protein. Proteins in this f 93.33
PRK00286443 xseA exodeoxyribonuclease VII large subunit; Reviewed 92.43
COG4085204 Predicted RNA-binding protein, contains TRAM domain [Ge 90.7
COG1570440 XseA Exonuclease VII, large subunit [DNA replication, r 90.45
KOG3108265 consensus 90.01
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 99.54
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 99.42
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 99.23
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 99.19
PRK00488338 pheS phenylalanyl-tRNA synthetase subunit alpha; Valida 99.02
COG0124429 HisS Histidyl-tRNA synthetase [Translation, ribosomal s 98.92
CHL00201424 syh histidine-tRNA synthetase; Provisional 98.9
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 98.89
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 98.89
PRK00037417 hisS histidyl-tRNA synthetase; Reviewed 98.8
PRK12420421 histidyl-tRNA synthetase; Provisional 98.79
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetase (Hi 98.79
PRK12292388 hisZ ATP phosphoribosyltransferase regulatory subunit; 98.71
pfam00587170 tRNA-synt_2b tRNA synthetase class II core domain (G, H 98.64
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA s 98.49
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II 98.45
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like cla 98.34
PRK12421391 ATP phosphoribosyltransferase regulatory subunit; Provi 98.31
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) clas 98.16
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II core 98.14
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II co 98.06
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core 98.06
PRK12325438 prolyl-tRNA synthetase; Provisional 97.96
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subunit; 97.82
KOG1936 518 consensus 97.74
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subunit; 97.62
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, ribosomal s 97.52
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 97.4
PRK12304604 thrS threonyl-tRNA synthetase; Reviewed 97.38
PRK03991613 threonyl-tRNA synthetase; Validated 97.32
PRK09194 570 prolyl-tRNA synthetase; Provisional 97.27
PRK03772642 threonyl-tRNA synthetase; Validated 97.26
PRK05431422 seryl-tRNA synthetase; Provisional 96.99
TIGR00442446 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The 96.71
KOG2324457 consensus 96.71
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal stru 96.67
COG3705390 HisZ ATP phosphoribosyltransferase involved in histidin 95.94
PRK08661478 prolyl-tRNA synthetase; Provisional 95.49
KOG2509455 consensus 91.88
KOG10351351 consensus 91.21
TIGR00408 533 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 90.97
pfam03590244 AsnA Aspartate-ammonia ligase. 90.92
TIGR00409 620 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 90.75
PTZ00326505 phenylalanyl-tRNA synthetase; Provisional 99.32
PRK04172501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 99.27
PRK06253527 O-phosphoseryl-tRNA synthetase; Reviewed 98.58
PRK05672 1050 dnaE2 error-prone DNA polymerase; Validated 97.77
PRK04173460 glycyl-tRNA synthetase; Provisional 97.41
PRK06658 1145 consensus 97.08
KOG2784483 consensus 97.01
PRK06637 1182 consensus 96.29
KOG2298 599 consensus 96.1
KOG2783436 consensus 93.04
COG0423 558 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ri 97.97
TIGR00389 606 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR00231 96.22
PRK12305576 thrS threonyl-tRNA synthetase; Reviewed 97.73
PRK06826 1157 dnaE DNA polymerase III DnaE; Reviewed 97.68
PRK07012 1173 consensus 97.38
PRK09074 1149 consensus 97.27
PRK06326 1240 consensus 95.8
TIGR00418595 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The 97.36
PRK04483634 threonyl-tRNA synthetase; Validated 97.33
PRK00413639 thrS threonyl-tRNA synthetase; Reviewed 97.31
PRK12444639 threonyl-tRNA synthetase; Reviewed 97.27
PRK04036497 DNA polymerase II small subunit; Validated 97.11
PRK10917 677 ATP-dependent DNA helicase RecG; Provisional 92.32
PRK07373447 DNA polymerase III subunit alpha; Reviewed 97.01
COG2024 536 Phenylalanyl-tRNA synthetase alpha subunit (archaeal ty 95.27
TIGR00468362 pheS phenylalanyl-tRNA synthetase, alpha subunit; Inter 94.77
cd00733279 GlyRS_alpha_core Class II Glycyl-tRNA synthetase (GlyRS 93.76
TIGR00470 558 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR 92.29
PRK13902 898 alaS lanyl-tRNA synthetase; Provisional 95.09
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 94.92
TIGR00469 460 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR00 94.13
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 90.47
PRK09348291 glyQ glycyl-tRNA synthetase subunit alpha; Validated 94.24
pfam02091284 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit. 93.69
PRK09616546 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 93.58
TIGR00389 606 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR00231 90.54
cd00769198 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) be 94.04
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1885 consensus Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase; InterPro: IPR002313 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0555 consensus Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2411 consensus Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0556 consensus Back     alignment and domain information
>KOG0554 consensus Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>pfam00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>PRK09350 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR004525 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK05425 asparagine synthetase AsnA; Provisional Back     alignment and domain information
>cd00645 AsnA Asparagine synthetase (aspartate-ammonia ligase) (AsnA) catalyses the conversion of L-aspartate to L-asparagine in the presence of ATP and ammonia Back     alignment and domain information
>PTZ00213 asparagine synthetase A; Provisional Back     alignment and domain information
>COG2502 AsnA Asparagine synthetase A [Amino acid transport and metabolism] Back     alignment and domain information
>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04319 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) Back     alignment and domain information
>cd04320 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>cd04321 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae mitochondrial (mt) aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04318 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS Back     alignment and domain information
>pfam01336 tRNA_anti OB-fold nucleic acid binding domain Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit Back     alignment and domain information
>cd04483 hOBFC1_like hOBFC1_like: A subfamily of OB folds similar to that found in human OB fold containing protein 1 (hOBFC1) Back     alignment and domain information
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ Back     alignment and domain information
>cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>COG5235 RFA2 Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04479 RPA3 RPA3: A subfamily of OB folds similar to human RPA3 (also called RPA14) Back     alignment and domain information
>COG3111 Periplasmic protein with OB-fold [Function unknown] Back     alignment and domain information
>pfam04076 BOF Bacterial OB fold (BOF) protein Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>COG4085 Predicted RNA-binding protein, contains TRAM domain [General function prediction only] Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3108 consensus Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>KOG1936 consensus Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12304 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK03772 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2324 consensus Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2509 consensus Back     alignment and domain information
>KOG1035 consensus Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam03590 AsnA Aspartate-ammonia ligase Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05672 dnaE2 error-prone DNA polymerase; Validated Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK06658 consensus Back     alignment and domain information
>KOG2784 consensus Back     alignment and domain information
>PRK06637 consensus Back     alignment and domain information
>KOG2298 consensus Back     alignment and domain information
>KOG2783 consensus Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR002315 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK07012 consensus Back     alignment and domain information
>PRK09074 consensus Back     alignment and domain information
>PRK06326 consensus Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK04483 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>COG2024 Phenylalanyl-tRNA synthetase alpha subunit (archaeal type) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit; InterPro: IPR004529 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00733 GlyRS_alpha_core Class II Glycyl-tRNA synthetase (GlyRS) alpha subunit core catalytic domain Back     alignment and domain information
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR005246 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK13902 alaS lanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00469 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR004530 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>PRK09348 glyQ glycyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>pfam02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit Back     alignment and domain information
>PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information