255764513

255764513

glutamyl-tRNA synthetase

GeneID in NCBI database:8210142Locus tag:CLIBASIA_05095
Protein GI in NCBI database:255764513Protein Accession:YP_003065530.2
Gene range:+(1119031, 1120509)Protein Length:492aa
Gene description:glutamyl-tRNA synthetase
COG prediction:none
KEGG prediction:gltX; glutamyl-tRNA synthetase (EC:6.1.1.17); K01885 glutamyl-tRNA synthetase [EC:6.1.1.17]
SEED prediction:Glutamyl-tRNA synthetase (EC 6.1.1.17)
Pathway involved in KEGG:Porphyrin and chlorophyll metabolism [PATH:las00860]
Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:Heme and Siroheme Biosynthesis;
tRNA aminoacylation, Glu and Gln
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490--
MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNHKKKELK
ccccccEEEEccccccccccHHHHHHHHHHHHHHHHHccEEEEEEccccccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccEEEEEccccccEEEccccEEEEEcccccccccEEEEccccHHHHHHHHHHHHHccccEEEEccHHHccHHHHHHHHHHccccccEEEEEEEEEcccccccccccccccHHHHHHccccHHHHHHHHHHccccccccccccccHHHHHHcccHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccEEEEccccccccEHHHHHHHHHHHHHHHHcccEEEEcEcccccccccccHHHHHHHHHHHccccccEEcccEccccccEHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHHHcccccEEEEccccccEEEEEEcccEEEEEEHHHccccEEEcccccEcHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHcccccEEEEEcccEcccccEccccccccEHHHHHHccccHHHHHHHHHcccccccccccHHccHHHHHHHccHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccEEEEEccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccHHHcc
missskvrvriapsptgephigTAYTALFNYLIAKRTggkfilriedtdskrstlESENAVMQSLKWCglnwdegpdiggaygpyrqserkniyQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRkrnipsrydghclkLSSQEIERLSQEQKKHVVrltvpnqgscvfqdkvygemeipwnaVDMQVLLksdgmptyhlANVIDDHLMKITHvargeewissVPKHILLYqyfnfpipefihlpliknpdksklskrrnptsisYYSAMGYLPEALINFLALLFVhksedddeLMDMQQLIHHfdlhhlskagavfdkqkldwlngrwirekLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFlfksdlhltaesfkstalcPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAitgskyslplfdsieiLGRSVVYFRLRHAIALVSSLVQnhkkkelk
missskvrvriapsptgephigtAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMrraqrkrnipsrydghcLKLSSQEIERLSQEQKKHvvrltvpnqgscvFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIknpdksklskrrnPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVsslvqnhkkkelk
MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNHKKKELK
****SKV*VRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERL*****************GHCLKLS*QEI*****EQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI****************
**********IAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQ********
****SKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNHKKKELK
MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNHKKKELK
MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNHKKKELK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target492 glutamyl-tRNA synthetase [Candidatus Liberibacter asiat
315122582483 glutamyl-tRNA synthetase [Candidatus Liberibacter solan 1 0.0
222087176485 glutamyl-tRNA synthetase protein [Agrobacterium radioba 1 0.0
227823481485 glutamyl-tRNA synthetase [Sinorhizobium fredii NGR234] 1 1e-179
15966656485 glutamyl-tRNA synthetase [Sinorhizobium meliloti 1021] 1 1e-179
150397997485 glutamyl-tRNA synthetase [Sinorhizobium medicae WSM419] 1 1e-179
717082484 glutamyl-tRNA synthetase [Sinorhizobium meliloti] Lengt 1 1e-178
116253921488 glutamyl-tRNA synthetase [Rhizobium leguminosarum bv. v 1 1e-177
332717135485 glutamyl-tRNA synthetase [Agrobacterium sp. H13-3] Leng 1 1e-177
159186179485 glutamyl-tRNA synthetase [Agrobacterium tumefaciens str 1 1e-177
241206403488 glutamyl-tRNA synthetase [Rhizobium leguminosarum bv. t 1 1e-176
>gi|315122582|ref|YP_004063071.1| glutamyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 483 Back     alignment and organism information
 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/483 (84%), Positives = 454/483 (93%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M ++S +RVRIAPSPTGEPHIGTAYTALFNYLIAK TGGKFILRIEDTDSKRSTLESENA
Sbjct: 1   MTANSDLRVRIAPSPTGEPHIGTAYTALFNYLIAKSTGGKFILRIEDTDSKRSTLESENA 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
           V++SLKWCGL+WDEGPDIGG+YGPYRQSERK+IYQPYVQNLL+KKLAFRCFCS ERL+EM
Sbjct: 61  VIKSLKWCGLHWDEGPDIGGSYGPYRQSERKDIYQPYVQNLLDKKLAFRCFCSEERLKEM 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R +QRK+NIPS+YDGHCL+LSSQEIERLSQE+K HVVRL +P+QG C FQDKVYG +EIP
Sbjct: 121 RFSQRKKNIPSKYDGHCLRLSSQEIERLSQEKKPHVVRLKIPDQGCCTFQDKVYGHVEIP 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           WNAVDMQVLLKSDGMPTYHLANV+DDHLMKITHVARGEEW+SSVPKHILLYQY NFP+PE
Sbjct: 181 WNAVDMQVLLKSDGMPTYHLANVVDDHLMKITHVARGEEWLSSVPKHILLYQYLNFPLPE 240

Query: 241 FIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           FIHLPLIKNPDKSKLSKR+NPTSISYYSAMGYLPEALINFLALLF+ K+E++DELM+MQQ
Sbjct: 241 FIHLPLIKNPDKSKLSKRKNPTSISYYSAMGYLPEALINFLALLFIQKNEEEDELMNMQQ 300

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLA 360
           LIHHF+L +LSKAGAVFD+QKLDWLNGRWIRE+LSTT+F+SRVSQW KE+DRLT+ALTLA
Sbjct: 301 LIHHFNLLNLSKAGAVFDRQKLDWLNGRWIREQLSTTDFISRVSQWTKEEDRLTKALTLA 360

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
           QSRI+T ++LP M DFLFKSDL+LT ESFK+ +L PEEI+ ILK TQEEFE IQIW REN
Sbjct: 361 QSRISTFASLPSMVDFLFKSDLYLTKESFKNISLTPEEIVTILKKTQEEFEGIQIWTREN 420

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           IETALRNVAQ  EKSLK+IVKPLFL+ITGSKYSLPLFDSIEILGRSVVY RL+HAI LV 
Sbjct: 421 IETALRNVAQSLEKSLKVIVKPLFLSITGSKYSLPLFDSIEILGRSVVYSRLKHAIQLVF 480

Query: 481 SLV 483
           SL+
Sbjct: 481 SLI 483


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087176|ref|YP_002545711.1| glutamyl-tRNA synthetase protein [Agrobacterium radiobacter K84] Length = 485 Back     alignment and organism information
>gi|227823481|ref|YP_002827454.1| glutamyl-tRNA synthetase [Sinorhizobium fredii NGR234] Length = 485 Back     alignment and organism information
>gi|15966656|ref|NP_387009.1| glutamyl-tRNA synthetase [Sinorhizobium meliloti 1021] Length = 485 Back     alignment and organism information
>gi|150397997|ref|YP_001328464.1| glutamyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 485 Back     alignment and organism information
>gi|717082|gb|AAC35209.1| glutamyl-tRNA synthetase [Sinorhizobium meliloti] Length = 484 Back     alignment and organism information
>gi|116253921|ref|YP_769759.1| glutamyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 488 Back     alignment and organism information
>gi|332717135|ref|YP_004444601.1| glutamyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 485 Back     alignment and organism information
>gi|159186179|ref|NP_356183.2| glutamyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 485 Back     alignment and organism information
>gi|241206403|ref|YP_002977499.1| glutamyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 488 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target492 glutamyl-tRNA synthetase [Candidatus Liberibacter asiat
PRK01406476 PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed 0.0
TIGR00464470 TIGR00464, gltX_bact, glutamyl-tRNA synthetase, bacteri 1e-132
KOG1149524 KOG1149, KOG1149, KOG1149, Glutamyl-tRNA synthetase (mi 1e-114
COG0008472 COG0008, GlnS, Glutamyl- and glutaminyl-tRNA synthetase 1e-123
pfam00749314 pfam00749, tRNA-synt_1c, tRNA synthetases class I (E an 1e-111
PRK12558445 PRK12558, PRK12558, glutamyl-tRNA synthetase; Provision 5e-66
PRK05710299 PRK05710, PRK05710, glutamyl-Q tRNA(Asp) synthetase; Re 1e-60
PRK14895513 PRK14895, gltX, glutamyl-tRNA synthetase; Provisional 3e-59
PRK12410433 PRK12410, PRK12410, glutamylglutaminyl-tRNA synthetase; 1e-58
TIGR00440522 TIGR00440, glnS, glutaminyl-tRNA synthetase 5e-10
PLN02627535 PLN02627, PLN02627, glutamyl-tRNA synthetase 1e-104
cd00808239 cd00808, GluRS_core, catalytic core domain of discrimin 2e-64
cd00418230 cd00418, GlxRS_core, catalytic core domain of glutamyl- 2e-42
TIGR03838272 TIGR03838, queuosine_YadB, glutamyl-queuosine tRNA(Asp) 2e-53
TIGR00463560 TIGR00463, gltX_arch, glutamyl-tRNA synthetase, archaea 2e-27
PTZ00402601 PTZ00402, PTZ00402, glutamyl-tRNA synthetase; Provision 1e-12
cd00808239 cd00808, GluRS_core, catalytic core domain of discrimin 8e-49
cd00418230 cd00418, GlxRS_core, catalytic core domain of glutamyl- 1e-31
PRK04156567 PRK04156, gltX, glutamyl-tRNA synthetase; Provisional 1e-23
cd09287240 cd09287, GluRS_non_core, catalytic core domain of non-d 3e-17
PRK14703 771 PRK14703, PRK14703, glutaminyl-tRNA synthetase/YqeY dom 2e-09
PRK05347554 PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisi 8e-05
PLN02859788 PLN02859, PLN02859, glutamine-tRNA ligase 0.001
cd00807238 cd00807, GlnRS_core, catalytic core domain of glutaminy 1e-10
PLN02907722 PLN02907, PLN02907, glutamate-tRNA ligase 1e-07
PTZ00437574 PTZ00437, PTZ00437, glutaminyl-tRNA synthetase; Provisi 0.001
cd09287240 cd09287, GluRS_non_core, catalytic core domain of non-d 3e-10
PRK04156567 PRK04156, gltX, glutamyl-tRNA synthetase; Provisional 5e-10
KOG1147712 KOG1147, KOG1147, KOG1147, Glutamyl-tRNA synthetase [Tr 4e-09
KOG1148764 KOG1148, KOG1148, KOG1148, Glutaminyl-tRNA synthetase [ 1e-07
PLN03233523 PLN03233, PLN03233, putative glutamate-tRNA ligase; Pro 2e-07
>gnl|CDD|179296 PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161891 TIGR00464, gltX_bact, glutamyl-tRNA synthetase, bacterial family Back     alignment and domain information
>gnl|CDD|36364 KOG1149, KOG1149, KOG1149, Glutamyl-tRNA synthetase (mitochondrial) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30358 COG0008, GlnS, Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144374 pfam00749, tRNA-synt_1c, tRNA synthetases class I (E and Q), catalytic domain Back     alignment and domain information
>gnl|CDD|183594 PRK12558, PRK12558, glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|180216 PRK05710, PRK05710, glutamyl-Q tRNA(Asp) synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|184889 PRK14895, gltX, glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|183510 PRK12410, PRK12410, glutamylglutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|161880 TIGR00440, glnS, glutaminyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178234 PLN02627, PLN02627, glutamyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173905 cd00808, GluRS_core, catalytic core domain of discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|185672 cd00418, GlxRS_core, catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|163550 TIGR03838, queuosine_YadB, glutamyl-queuosine tRNA(Asp) synthetase Back     alignment and domain information
>gnl|CDD|161890 TIGR00463, gltX_arch, glutamyl-tRNA synthetase, archaeal and eukaryotic family Back     alignment and domain information
>gnl|CDD|173593 PTZ00402, PTZ00402, glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|173905 cd00808, GluRS_core, catalytic core domain of discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|185672 cd00418, GlxRS_core, catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|179754 PRK04156, gltX, glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|185682 cd09287, GluRS_non_core, catalytic core domain of non-discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|184797 PRK14703, PRK14703, glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|180031 PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178450 PLN02859, PLN02859, glutamine-tRNA ligase Back     alignment and domain information
>gnl|CDD|185676 cd00807, GlnRS_core, catalytic core domain of glutaminyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|178495 PLN02907, PLN02907, glutamate-tRNA ligase Back     alignment and domain information
>gnl|CDD|185617 PTZ00437, PTZ00437, glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|185682 cd09287, GluRS_non_core, catalytic core domain of non-discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|179754 PRK04156, gltX, glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|36362 KOG1147, KOG1147, KOG1147, Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36363 KOG1148, KOG1148, KOG1148, Glutaminyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178772 PLN03233, PLN03233, putative glutamate-tRNA ligase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 492 glutamyl-tRNA synthetase [Candidatus Liberibacter asiat
PRK00574489 gltX glutamyl-tRNA synthetase; Reviewed 100.0
TIGR00464513 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 100.0
PRK01406467 gltX glutamyl-tRNA synthetase; Reviewed 100.0
PRK12558461 glutamyl-tRNA synthetase; Provisional 100.0
KOG1149524 consensus 100.0
PRK12410433 glutamyl-tRNA synthetase; Provisional 100.0
COG0008472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Transla 100.0
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 99.7
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 99.38
TIGR00467539 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904 Th 97.25
pfam00749314 tRNA-synt_1c tRNA synthetases class I (E and Q), cataly 100.0
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 100.0
cd00808239 GluRS_core Descriminating Glutamyl-tRNA synthetase (Glu 100.0
cd00418223 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-t 100.0
cd00807238 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) a 100.0
TIGR00463600 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 100.0
PRK05347556 glutaminyl-tRNA synthetase; Provisional 100.0
KOG1147712 consensus 100.0
TIGR00440564 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514 Th 100.0
KOG1148764 consensus 100.0
PRK11893512 methionyl-tRNA synthetase; Reviewed 99.24
pfam01406301 tRNA-synt_1e tRNA synthetases class I (C) catalytic dom 99.01
PRK12268558 methionyl-tRNA synthetase; Reviewed 98.99
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 98.98
PRK00133 666 metG methionyl-tRNA synthetase; Reviewed 98.97
PRK12267 644 methionyl-tRNA synthetase; Reviewed 98.84
COG0143558 MetG Methionyl-tRNA synthetase [Translation, ribosomal 98.61
TIGR00398573 metG methionyl-tRNA synthetase; InterPro: IPR002304 The 97.74
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 97.24
PRK04156566 gltX glutamyl-tRNA synthetase; Provisional 100.0
cd00814319 MetRS_core This is the catalytic core domain of methion 99.33
cd00668334 Ile_Leu_Val_MetRS_core This is the catalytic core domai 99.3
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deo 99.05
PRK00260460 cysS cysteinyl-tRNA synthetase; Validated 99.01
PRK12418384 cysteinyl-tRNA synthetase; Provisional 98.93
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal 98.67
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 98.58
cd00395274 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Trypt 98.56
cd00674354 LysRS_core_class_I This is the catalytic core domain of 98.53
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 98.53
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 98.39
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 98.28
cd00806282 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalyt 98.18
cd00818339 IleRS_core This is the catalytic core domain of isoleuc 98.06
PRK12285369 tryptophanyl-tRNA synthetase; Reviewed 97.05
cd00672213 CysRS_core This is the catalytic core domain of cystein 96.82
TIGR00233366 trpS tryptophanyl-tRNA synthetase; InterPro: IPR002306 96.41
KOG2007586 consensus 94.47
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 99.94
PRK00927325 tryptophanyl-tRNA synthetase; Reviewed 98.1
PRK12284436 tryptophanyl-tRNA synthetase; Reviewed 98.06
PRK12556328 tryptophanyl-tRNA synthetase; Provisional 97.9
PRK08560333 tyrosyl-tRNA synthetase; Validated 97.9
KOG2713347 consensus 93.15
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 99.45
PRK12451562 arginyl-tRNA synthetase; Reviewed 99.34
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 99.23
pfam09334388 tRNA-synt_1g tRNA synthetases class I (M). This family 99.21
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 98.37
cd00817363 ValRS_core This is the catalytic core domain of valine 98.31
PRK05729 877 valS valyl-tRNA synthetase; Reviewed 97.76
PRK13208 809 valS valyl-tRNA synthetase; Reviewed 97.75
PRK06039 1042 ileS isoleucyl-tRNA synthetase; Reviewed 97.47
PRK13804 966 ileS isoleucyl-tRNA synthetase; Provisional 97.29
PRK00390 822 leuS leucyl-tRNA synthetase; Validated 97.24
PRK05743 910 ileS isoleucyl-tRNA synthetase; Reviewed 97.23
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal stru 96.87
COG0495 814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 96.64
TIGR00396 916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 96.47
KOG0435 876 consensus 94.3
KOG0432 995 consensus 91.61
cd00671267 ArgRS_core This is the catalytic core domain of Arginyl 98.79
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 97.81
cd00812376 LeuRS_core This is the catalytic core domain of leucyl 98.56
PRK12300888 leuS leucyl-tRNA synthetase; Reviewed 94.25
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 97.7
pfam00133606 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). O 97.56
TIGR00422 970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 97.42
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 97.04
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 96.51
>PRK00574 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00464 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12558 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1149 consensus Back     alignment and domain information
>PRK12410 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00467 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain Back     alignment and domain information
>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed Back     alignment and domain information
>cd00808 GluRS_core Descriminating Glutamyl-tRNA synthetase (GluRS) catalytic core domain Back     alignment and domain information
>cd00418 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain Back     alignment and domain information
>cd00807 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) and non-descriminating Glutamyl-tRNA synthetase (GluRS) cataytic core domain Back     alignment and domain information
>TIGR00463 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK05347 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1147 consensus Back     alignment and domain information
>TIGR00440 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1148 consensus Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase; InterPro: IPR002304 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS) Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>cd00395 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain Back     alignment and domain information
>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS) Back     alignment and domain information
>pfam00579 tRNA-synt_1b tRNA synthetases class I (W and Y) Back     alignment and domain information
>pfam01921 tRNA-synt_1f tRNA synthetases class I (K) Back     alignment and domain information
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00806 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain Back     alignment and domain information
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) Back     alignment and domain information
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00672 CysRS_core This is the catalytic core domain of cysteinyl tRNA synthetase (CysRS) Back     alignment and domain information
>TIGR00233 trpS tryptophanyl-tRNA synthetase; InterPro: IPR002306 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2007 consensus Back     alignment and domain information
>cd00802 class_I_aaRS_core Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain Back     alignment and domain information
>PRK00927 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK08560 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG2713 consensus Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam00750 tRNA-synt_1d tRNA synthetases class I (R) Back     alignment and domain information
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M) Back     alignment and domain information
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0435 consensus Back     alignment and domain information
>KOG0432 consensus Back     alignment and domain information
>cd00671 ArgRS_core This is the catalytic core domain of Arginyl tRNA synthetase (ArgRS) Back     alignment and domain information
>cd00805 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic core domain Back     alignment and domain information
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS) Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd02156 nt_trans nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain Back     alignment and domain information
>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target492 glutamyl-tRNA synthetase [Candidatus Liberibacter asiat
1j09_A468 Crystal Structure Of Thermus Thermophilus Glutamyl- 1e-106
1g59_A468 Glutamyl-Trna Synthetase Complexed With Trna(Glu). 1e-104
3al0_C592 Crystal Structure Of The Glutamine Transamidosome F 7e-99
3afh_A488 Crystal Structure Of Thermotoga Maritima Nondiscrim 1e-98
3akz_B487 Crystal Structure Of Thermotoga Maritima Nondiscrim 1e-98
2o5r_A481 Crystal Structure Of Glutamyl-Trna Synthetase 1 (Ec 8e-97
2ja2_A498 Mycobacterium Tuberculosis Glutamyl-Trna Synthetase 5e-89
2cfo_A492 Non-Discriminating Glutamyl-Trna Synthetase From Th 3e-85
1irx_A523 Crystal Structure Of Class I Lysyl-Trna Synthetase 2e-07
3aii_A553 Archaeal Non-Discriminating Glutamyl-Trna Synthetas 2e-47
1nzj_A298 Crystal Structure And Activity Studies Of Escherich 8e-42
2hz7_A 851 Crystal Structure Of The Glutaminyl-Trna Synthetase 1e-36
2rd2_A556 Glutaminyl-Trna Synthetase Mutant C229r With Bound 1e-35
1nyl_A539 Unliganded Glutaminyl-Trna Synthetase Length = 539 2e-34
1euq_A548 Crystal Structure Of Glutaminyl-Trna Synthetase Com 2e-34
1qru_A553 Glutaminyl-Trna Synthetase Mutant I129t Complexed W 2e-34
1gsg_P553 Structure Of E.Coli Glutaminyl-Trna Synthetase Comp 2e-34
1qrs_A553 Glutaminyl-Trna Synthetase Mutant D235n Complexed W 2e-34
1o0b_A554 Crystal Structure Of L-Glutamine And Ampcpp Bound T 2e-34
1qrt_A553 Glutaminyl-Trna Synthetase Mutant D235g Complexed W 3e-34
gi|28948411|pdb|1J09|A Chain A, Crystal Structure Of Thermus Thermophilus Glutamyl-Trna Synthetase Complexed With Atp And Glu Length = 468 Back     alignment and structure
 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 191/478 (39%), Positives = 283/478 (59%), Gaps = 18/478 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V  RIAPSPTG+PH+GTAY ALFNY  A+R GG+FI+RIEDTD  R    +E  ++ +LK
Sbjct: 2   VVTRIAPSPTGDPHVGTAYIALFNYAWARRNGGRFIVRIEDTDRARYVPGAEERILAALK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL++DEGPD+GG +GPYRQSER  +YQ Y + LL++  A+R F + E LE++R+ +  
Sbjct: 62  WLGLSYDEGPDVGGPHGPYRQSERLPLYQKYAEELLKRGWAYRAFETPEELEQIRKEKGG 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
            +      G    +  +E E  ++  + HV+RL VP  G+   +D++ G +      +  
Sbjct: 122 YD------GRARNIPPEEAEERARRGEPHVIRLKVPRPGTTEVKDELRGVVVYDNQEIPD 175

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            VLLKSDG PTYHLANV+DDHLM +T V R EEW+ S P H+LLY+ F +  P F H+PL
Sbjct: 176 VVLLKSDGYPTYHLANVVDDHLMGVTDVIRAEEWLVSTPIHVLLYRAFGWEAPRFYHMPL 235

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDK+K+SKR++ TS+ +Y A G+LPEAL N+L L+     +  + +  +++ I  F 
Sbjct: 236 LRNPDKTKISKRKSHTSLDWYKAEGFLPEALRNYLCLMGFSMPDGRE-IFTLEEFIQAFT 294

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-------MKEKDRLTQALTL 359
              +S  G VFD +KL W+NG++IRE LS  E   RV  +        + +  L +A+ L
Sbjct: 295 WERVSLGGPVFDLEKLRWMNGKYIREVLSLEEVAERVKPFLREAGLSWESEAYLRRAVEL 354

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            + R  TL   P+   +LF  D  ++ ++ +      EE + +LK         + W   
Sbjct: 355 MRPRFDTLKEFPEKARYLFTEDYPVSEKAQRKL----EEGLPLLKELYPRLRAQEEWTEA 410

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            +E  LR  A  +   L  + +PL  A+TGS  +  LF+ + +LG+     RL  A+A
Sbjct: 411 ALEALLRGFAAEKGVKLGQVAQPLRAALTGSLETPGLFEILALLGKERALRRLERALA 468


gi|15826583|pdb|1G59|A Chain A, Glutamyl-Trna Synthetase Complexed With Trna(Glu). Length = 468 Back     alignment and structure
>gi|307776357|pdb|3AL0|C Chain C, Crystal Structure Of The Glutamine Transamidosome From Thermotoga Maritima In The Glutamylation State Length = 592 Back     alignment and structure
>gi|299856675|pdb|3AFH|A Chain A, Crystal Structure Of Thermotoga Maritima Nondiscriminating Glutamyl- Trna Synthetase In Complex With A Glutamyl-Amp Analog Length = 488 Back     alignment and structure
gi|307776347|pdb|3AKZ|B Chain B, Crystal Structure Of Thermotoga Maritima Nondiscriminating Glutamyl- Trna Synthetase In Complex With Trnagln And A Glutamyl-Amp Analog Length = 487 Back     alignment and structure
>gi|122921441|pdb|2O5R|A Chain A, Crystal Structure Of Glutamyl-Trna Synthetase 1 (Ec 6.1.1.17) (Glutamate-Trna Ligase 1) (Glurs 1) (Tm1351) From Thermotoga Maritima At 2.5 A Resolution Length = 481 Back     alignment and structure
>gi|210060724|pdb|2JA2|A Chain A, Mycobacterium Tuberculosis Glutamyl-Trna Synthetase Length = 498 Back     alignment and structure
>gi|114793606|pdb|2CFO|A Chain A, Non-Discriminating Glutamyl-Trna Synthetase From Thermosynechococcus Elongatus In Complex With Glu Length = 492 Back     alignment and structure
>gi|20663866|pdb|1IRX|A Chain A, Crystal Structure Of Class I Lysyl-Trna Synthetase Length = 523 Back     alignment and structure
gi|302148693|pdb|3AII|A Chain A, Archaeal Non-Discriminating Glutamyl-Trna Synthetase From Methanothermobacter Thermautotrophicus Length = 553 Back     alignment and structure
gi|48425079|pdb|1NZJ|A Chain A, Crystal Structure And Activity Studies Of Escherichia Coli Yadb Orf Length = 298 Back     alignment and structure
>gi|146386870|pdb|2HZ7|A Chain A, Crystal Structure Of The Glutaminyl-Trna Synthetase From Deinococcus Radiodurans Length = 851 Back     alignment and structure
>gi|165761087|pdb|2RD2|A Chain A, Glutaminyl-Trna Synthetase Mutant C229r With Bound Analog 5'-O-[n-(L-Glutaminyl)-Sulfamoyl]adenosine Length = 556 Back     alignment and structure
>gi|28949039|pdb|1NYL|A Chain A, Unliganded Glutaminyl-Trna Synthetase Length = 539 Back     alignment and structure
>gi|8569293|pdb|1EUQ|A Chain A, Crystal Structure Of Glutaminyl-Trna Synthetase Complexed With A Trna-Gln Mutant And An Active-Site Inhibitor Length = 548 Back     alignment and structure
>gi|1942958|pdb|1QRU|A Chain A, Glutaminyl-Trna Synthetase Mutant I129t Complexed With Glutamine Transfer Rna Length = 553 Back     alignment and structure
>gi|229955|pdb|1GSG|P Chain P, Structure Of E.Coli Glutaminyl-Trna Synthetase Complexed With Trnagln And Atp At 2.8 Angstroms Resolution Length = 553 Back     alignment and structure
>gi|1942954|pdb|1QRS|A Chain A, Glutaminyl-Trna Synthetase Mutant D235n Complexed With Glutamine Transfer Rna Length = 553 Back     alignment and structure
gi|30749806|pdb|1O0B|A Chain A, Crystal Structure Of L-Glutamine And Ampcpp Bound To Glutamine Aminoacyl Trna Synthetase Length = 554 Back     alignment and structure
>gi|1942956|pdb|1QRT|A Chain A, Glutaminyl-Trna Synthetase Mutant D235g Complexed With Glutamine Transfer Rna Length = 553 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target492 glutamyl-tRNA synthetase [Candidatus Liberibacter asiat
3al0_C592 Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA 1e-127
3afh_A488 Glutamyl-tRNA synthetase 2; protein-substrate complex, 1e-121
1j09_A468 Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken 1e-115
2o5r_A481 Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutam 1e-109
2cfo_A492 Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthe 1e-96
2ja2_A498 Glutamyl-tRNA synthetase; non-discriminating glutamyl-t 2e-92
1irx_A523 Lysyl-tRNA synthetase; beta sandwitch, zinc-binding str 6e-52
2hz7_A 851 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, 1e-82
1qtq_A553 GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, 4e-81
1nzj_A298 Hypothetical protein YADB; Zn cluster, glutamyl T-RNA s 2e-73
3aii_A553 Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, l 4e-70
1iq0_A592 Arginyl-tRNA synthetase; riken structural genomics/prot 2e-04
>3al0_C Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA synthetase 2; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} Length = 592 Back     alignment and structure
 Score =  449 bits (1157), Expect = e-127
 Identities = 167/481 (34%), Positives = 267/481 (55%), Gaps = 31/481 (6%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  H+G A TALFN++ A++ GGKFILRIEDTD++RS+ E E  +++SL+
Sbjct: 130 VRVRFAPSPTGHLHVGGARTALFNWMFARKEGGKFILRIEDTDTERSSREYEQQILESLR 189

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           WCGL+WDEGPDIGG +GPYRQSER  IY+ Y + L+E K A+      E   +      +
Sbjct: 190 WCGLDWDEGPDIGGDFGPYRQSERLEIYREYAEKLVEDKRAYYVVYDKEDPSKELFTTYE 249

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                +  GH                    ++  V   G   F+D + G ME   + ++ 
Sbjct: 250 YPHEYKEKGHP-----------------VTIKFKVLP-GKTSFEDLLKGYMEFDNSTLED 291

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +++KS+G PTY+ A V+DDHLM+I+HV RGE+ +S+ PK +++Y+ F +  P F+H+PL
Sbjct: 292 FIIMKSNGFPTYNFAVVVDDHLMRISHVFRGEDHLSNTPKQLMIYEAFGWEAPVFMHIPL 351

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D++ LSKR   TS+ ++   G L  AL+N+LALL      + DE+  +++ +  FD
Sbjct: 352 ILGSDRTPLSKRHGATSVEHFRREGILSRALMNYLALLGWRV--EGDEIFTIEEKLQSFD 409

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALT-------- 358
              +S  G +FD QKL+W+NG+ +R ++   +      +W K   +   ++         
Sbjct: 410 PKDISNKGVIFDYQKLEWVNGKHMR-RIDLEDLKREFIEWAKYAGKEIPSVDERYFSETL 468

Query: 359 -LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            + + ++ TLS L  +       D     +  +   L  EE   +L+  ++ F+ +  W 
Sbjct: 469 RICREKVNTLSQLYDIMYPFMNDDYEYEKDYVEK-FLKREEAERVLEEAKKAFKDLNSWN 527

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E IE  LR++++    S K++ + +  A+TG   +  LF++IE+LG+     RL   + 
Sbjct: 528 MEEIEKTLRDLSEKGLASKKVVFQLIRGAVTGKLVTPGLFETIEVLGKERTLKRLERTLQ 587

Query: 478 L 478
            
Sbjct: 588 F 588


>3afh_A Glutamyl-tRNA synthetase 2; protein-substrate complex, aminoacyl-tRNA synthetase, ATP-binding, ligase, nucleotide-binding; HET: GSU; 2.00A {Thermotoga maritima} Length = 488 Back     alignment and structure
>1j09_A Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLU ATP; 1.80A {Thermus thermophilus} SCOP: a.97.1.1 c.26.1.1 PDB: 1n75_A* 1n77_A* 1n78_A* 2cuz_A* 2cv0_A* 2cv1_A* 2cv2_A* 2dxi_A* 1g59_A 1gln_A Length = 468 Back     alignment and structure
>2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate- tRNA ligase 1, glurs 1, structural genomics; 2.34A {Thermotoga maritima} Length = 481 Back     alignment and structure
>2cfo_A Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide- binding, protein biosynthesis; HET: GLU; 2.45A {Synechococcus elongatus} Length = 492 Back     alignment and structure
>2ja2_A Glutamyl-tRNA synthetase; non-discriminating glutamyl-tRNA aminoacylation, protein biosynthesis, aminoacyl-tRNA synthetase, ligase; 1.65A {Mycobacterium tuberculosis} Length = 498 Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Length = 523 Back     alignment and structure
>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} Length = 851 Back     alignment and structure
>1qtq_A GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, trnaGln, E. coli, complex, ligase/RNA complex; HET: QSI; 2.25A {Escherichia coli} SCOP: b.53.1.2 c.26.1.1 PDB: 1gsg_P* 1gts_A* 1gtr_A* 1zjw_A* 1o0b_A* 1o0c_A* 1qru_A* 1qrs_A* 1qrt_A* 1euy_A* 1euq_A* 1exd_A* 2rd2_A* 2re8_A* 1nyl_A Length = 553 Back     alignment and structure
>1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* Length = 298 Back     alignment and structure
>3aii_A Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, ligase; 1.65A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 553 Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Length = 592 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target492 glutamyl-tRNA synthetase [Candidatus Liberibacter asiat
2ja2_A498 Glutamyl-tRNA synthetase; non-discriminating glutamyl-t 100.0
1j09_A468 Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken 100.0
2cfo_A492 Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthe 100.0
3afh_A488 Glutamyl-tRNA synthetase 2; protein-substrate complex, 100.0
2o5r_A481 Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutam 100.0
3al0_C592 Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA 100.0
1irx_A523 Lysyl-tRNA synthetase; beta sandwitch, zinc-binding str 100.0
1qtq_A553 GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, 100.0
2hz7_A 851 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, 100.0
1nzj_A298 Hypothetical protein YADB; Zn cluster, glutamyl T-RNA s 100.0
3aii_A553 Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, l 100.0
1iq0_A592 Arginyl-tRNA synthetase; riken structural genomics/prot 99.1
2csx_A497 Methionyl-tRNA synthetase; ligase, riken structural gen 99.06
3fnr_A464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, s 98.98
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, protein 98.96
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerization, l 98.62
3c8z_A414 Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fo 99.22
1li5_A461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cys 99.21
3hzr_A386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structur 98.36
2g36_A340 Tryptophanyl-tRNA synthetase; TM0492, structural genomi 98.35
2cyb_A323 Tyrosyl-tRNA synthetase; rossmann-fold, structural geno 98.31
1yi8_B351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A { 98.3
3m5w_A322 Tryptophanyl-tRNA synthetase; alpha-beta structure, csg 98.26
2dlc_X394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase/tRN 98.25
2el7_A337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase 98.18
3jxe_A<