254781121

254781121

hypothetical protein CLIBASIA_05115

GeneID in NCBI database:8210146Locus tag:CLIBASIA_05115
Protein GI in NCBI database:254781121Protein Accession:YP_003065534.1
Gene range:-(1124231, 1124788)Protein Length:185aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:conserved hypothetical signal peptide protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHccccEEEEEEccccccEEEEEccccccccccccccccEEEEEEEEcccccccEEEEEEccccccccEEEEEEccccccccEEEEEEcccccccccccHHHHHHHHHHcccEEEEEEEcccccEEEEEEccccHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccccccEEcccccEEEEEEccccccEEEEEEEccccccccccccccEEEEEEEccccccccEEEEEccccccccccEEEEEcccEccEEEEEEEEcccccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHcc
MFLNVLKDFFVPRIRFLIVLMVSSVsagyanasqpeptlrnqfsrwsvyvypdlnkklcfslsvpvtveplegvrhGVNFFIISLKKEENSAYVSELVmdypldeeeMVSLEvkgknasgtIFKMKSynnraafekrsQDTVLIEEMKRGKELVVSAkskrgtntRYIYSLIGLsdsladirkcn
mflnvlkdFFVPRIRFLIVLMVSSVSAGyanasqpeptlrnqfSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEvkgknasgtifkmksynnraafekrsqdtvlieemkrgkelvvsakskrgtntryiysliglsdsladirkcn
MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN
*******DFFVPRIRFLIVLMVSSVSAGYA*********RNQFSRWSVYVYPDLNKKLCFSLS***************NFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKC*
MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN
MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN
MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN
MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target185 hypothetical protein CLIBASIA_05115 [Candidatus Liberib
315122585186 hypothetical protein CKC_04185 [Candidatus Liberibacter 1 4e-60
114705377168 hypothetical protein FP2506_10571 [Fulvimarina pelagi H 1 3e-24
222150076169 hypothetical protein Avi_4170 [Agrobacterium vitis S4] 1 1e-23
241518646164 hypothetical protein Rleg_5961 [Rhizobium leguminosarum 1 1e-23
15966968167 putative signal peptide protein [Sinorhizobium meliloti 1 6e-22
222087497215 hypothetical protein Arad_4379 [Agrobacterium radiobact 1 2e-21
116254250169 hypothetical protein RL4523 [Rhizobium leguminosarum bv 1 3e-21
150398263167 putative signal peptide protein [Sinorhizobium medicae 1 3e-21
325294044167 hypothetical protein AGROH133_08942 [Agrobacterium sp. 1 7e-21
86359511169 hypothetical protein RHE_CH03931 [Rhizobium etli CFN 42 1 9e-21
>gi|315122585|ref|YP_004063074.1| hypothetical protein CKC_04185 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 186 Back     alignment and organism information
 Score =  234 bits (597), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 143/185 (77%), Gaps = 1/185 (0%)

Query: 1   MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVY-PDLNKKLC 59
           MFL +LK+FF+   RF ++L+++     YA++    P LRN+F RW VY + PD N+K+C
Sbjct: 1   MFLRILKNFFIFGRRFFVLLIITGTPFAYADSINSNPVLRNEFIRWLVYYHSPDSNRKIC 60

Query: 60  FSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNAS 119
           ++++VP + +P  GV+HG+NFF+I LKKE   +Y+SELVMDYPLDE  MVS+EV GKN+S
Sbjct: 61  YTVTVPTSAQPETGVKHGINFFMIGLKKETKDSYISELVMDYPLDENTMVSIEVIGKNSS 120

Query: 120 GTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLA 179
           G IF M  +NNRA F+K S + +LI+EMK GKE++VSAKSKRGTNTRY+YSL GLSD+LA
Sbjct: 121 GQIFTMHPHNNRATFQKESDNEILIKEMKLGKEVIVSAKSKRGTNTRYVYSLSGLSDALA 180

Query: 180 DIRKC 184
           D+ KC
Sbjct: 181 DLPKC 185


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|114705377|ref|ZP_01438285.1| hypothetical protein FP2506_10571 [Fulvimarina pelagi HTCC2506] Length = 168 Back     alignment and organism information
>gi|222150076|ref|YP_002551033.1| hypothetical protein Avi_4170 [Agrobacterium vitis S4] Length = 169 Back     alignment and organism information
>gi|241518646|ref|YP_002979274.1| hypothetical protein Rleg_5961 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 164 Back     alignment and organism information
>gi|15966968|ref|NP_387321.1| putative signal peptide protein [Sinorhizobium meliloti 1021] Length = 167 Back     alignment and organism information
>gi|222087497|ref|YP_002546034.1| hypothetical protein Arad_4379 [Agrobacterium radiobacter K84] Length = 215 Back     alignment and organism information
>gi|116254250|ref|YP_770088.1| hypothetical protein RL4523 [Rhizobium leguminosarum bv. viciae 3841] Length = 169 Back     alignment and organism information
>gi|150398263|ref|YP_001328730.1| putative signal peptide protein [Sinorhizobium medicae WSM419] Length = 167 Back     alignment and organism information
>gi|325294044|ref|YP_004279908.1| hypothetical protein AGROH133_08942 [Agrobacterium sp. H13-3] Length = 167 Back     alignment and organism information
>gi|86359511|ref|YP_471403.1| hypothetical protein RHE_CH03931 [Rhizobium etli CFN 42] Length = 169 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 185 hypothetical protein CLIBASIA_05115 [Candidatus Liberib
pfam06776133 IalB Invasion associated locus B (IalB) protein. This f 99.86
COG5342181 Invasion protein B, involved in pathogenesis [General f 99.81
pfam06674 338 DUF1176 Protein of unknown function (DUF1176). This fam 98.81
>pfam06776 IalB Invasion associated locus B (IalB) protein Back     alignment and domain information
>COG5342 Invasion protein B, involved in pathogenesis [General function prediction only] Back     alignment and domain information
>pfam06674 DUF1176 Protein of unknown function (DUF1176) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target185 hypothetical protein CLIBASIA_05115 [Candidatus Liberib
3dtd_A175 Crystal Structure Of Invasion Associated Protein B 5e-05
>gi|198443315|pdb|3DTD|A Chain A, Crystal Structure Of Invasion Associated Protein B From Bartonella Henselae Length = 175 Back     alignment and structure
 Score = 51.5 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 50/157 (31%), Gaps = 11/157 (7%)

Query: 28  GYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKK 87
             A       +L   +  WS+       KK+CF           E          +S+  
Sbjct: 14  TVATLPNGASSLTETYGLWSINCGIQEGKKVCFMHRQ-------EVNDQNRVVVAMSVVL 66

Query: 88  EENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEM 147
             +      L + + +   + V L+V    A      +++            D   +  +
Sbjct: 67  NADGVVSGNLTVPFGILVSKPVRLQVDEGKA-VIETGIRTCVPAGCIVPIVFDKNYVAAL 125

Query: 148 KRGKELVVSAK-SKRGT-NTRYIY-SLIGLSDSLADI 181
           + GK L ++   +  G      ++  L G S++L  +
Sbjct: 126 RAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNRL 162


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target185 hypothetical protein CLIBASIA_05115 [Candidatus Liberib
3dtd_A175 Invasion-associated protein B; structural genomics, PSI 2e-16
>3dtd_A Invasion-associated protein B; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.35A {Bartonella henselae} Length = 175 Back     alignment and structure
 Score = 80.9 bits (199), Expect = 2e-16
 Identities = 28/171 (16%), Positives = 54/171 (31%), Gaps = 16/171 (9%)

Query: 21  MVSSVSAGYANASQP--EPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGV 78
              S +     A+ P    +L   +  WS+       KK+CF     V  +     R  V
Sbjct: 5   NSKSTTTKDTVATLPNGASSLTETYGLWSINCGIQEGKKVCFMHRQEVNDQN----RVVV 60

Query: 79  NFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRS 138
              ++       S  ++ +     + +   V L+V    A      +++           
Sbjct: 61  AMSVVLNADGVVSGNLT-VPFGILVSKP--VRLQVDEGKAVIE-TGIRTCVPAGCIVPIV 116

Query: 139 QDTVLIEEMKRGKELVVS---AKSKRGTNTRYIYSLIGLS---DSLADIRK 183
            D   +  ++ GK L ++   A             L G S   + L  ++K
Sbjct: 117 FDKNYVAALRAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNRLIALQK 167


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target185 hypothetical protein CLIBASIA_05115 [Candidatus Liberib
3dtd_A175 Invasion-associated protein B; structural genomics, PSI 99.94
>3dtd_A Invasion-associated protein B; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.35A {Bartonella henselae} Back     alignment and structure
Probab=99.94  E-value=9.8e-27  Score=181.75  Aligned_cols=142  Identities=16%  Similarity=0.200  Sum_probs=116.6

Q ss_pred             CCCHHHCCCCCEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEEEEECCCCCCCEEEEEC
Q ss_conf             01011012377589999359871655664120002344455553057998617877610368983103467772699971
Q gi|254781121|r   35 PEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVK  114 (185)
Q Consensus        35 ~~~~~~~~f~dW~v~~~~~~~~~~C~i~s~p~~~~~~~~~~~~~~~~~v~~~~~~~~~~~vs~~~gy~~~~~~~v~l~Id  114 (185)
                      ..+...++||||+++|..++++++|++.|.+...+     .+...++.+.++++++.  .+.+..|+++.+.+++.+.||
T Consensus        21 ~~~~~~etfgdW~v~C~~~~~~~~C~~~q~~~~~~-----~~~~~~~~v~~~~~~~~--~~~v~vPlG~~l~~g~~i~vD   93 (175)
T 3dtd_A           21 GASSLTETYGLWSINCGIQEGKKVCFMHRQEVNDQ-----NRVVVAMSVVLNADGVV--SGNLTVPFGILVSKPVRLQVD   93 (175)
T ss_dssp             ---CBCEEETTEEEEECCC---CCEEEEEEEEBTT-----CCEEEEEEEEECTTSCE--EEEEEECSSBCTTSCEEEEET
T ss_pred             CCCCCCCCCCCCEEEEECCCCCCEEEEEEEEECCC-----CCEEEEEEEEECCCCCE--EEEEEEECCCCCCCCCEEEEE
T ss_conf             88001125378527971379997799998775578-----98889999997889863--799999455105999789997


Q ss_pred             CCCCCCCCCCEECCCCCCEECCCCCCHHHHHHHHCCCEEEEEEEC---CCCCEEEEEEECCCHHHHHHHHHHC
Q ss_conf             665554443100037874102456696789997367769999991---8998899985144289999988734
Q gi|254781121|r  115 GKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKS---KRGTNTRYIYSLIGLSDSLADIRKC  184 (185)
Q Consensus       115 ~~~~~~~~~~~~~~~~~a~~~~~~~d~~~i~amk~G~~~~v~~~s---~~g~~~~~~~SL~GFt~A~~~~~kc  184 (185)
                      +++. ...+.|.+|++.||++....|+++|++||+|++++|.+..   .+|+.++++|||+||++||+++++|
T Consensus        94 ~g~~-~~~l~~~~C~~~gC~a~~~~~~~~i~amk~G~~~~v~~~~~~~~~~~~~~~~~SL~Gft~Al~~L~e~  165 (175)
T 3dtd_A           94 EGKA-VIETGIRTCVPAGCIVPIVFDKNYVAALRAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNRLIAL  165 (175)
T ss_dssp             TSSC-EEEECCCEEETTEEEEEEEECHHHHHHHHHCSEEEEEEEBSSTTCCEEEEEEEECTTHHHHHHHHHHH
T ss_pred             CCCC-EEEEEEEEECCCCEEEECCCCHHHHHHHHHCCCCEEEEEECCCCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             6984-05776788747852988368989999998188447999974688897788778424599999999998




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 185 hypothetical protein CLIBASIA_05115 [Candidatus Li
3dtd_A_175 (A:) Invasion-associated protein B; structural gen 2e-23
>3dtd_A (A:) Invasion-associated protein B; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.35A {Bartonella henselae}Length = 175 Back     alignment and structure
 Score =  102 bits (256), Expect = 2e-23
 Identities = 25/172 (14%), Positives = 50/172 (29%), Gaps = 11/172 (6%)

Query: 16  FLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVR 75
            L     ++     A       +L   +  WS+       KK+CF     V         
Sbjct: 2   SLSNSKSTTTKDTVATLPNGASSLTETYGLWSINCGIQEGKKVCFMHRQEVN-------D 54

Query: 76  HGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFE 135
                  +S+    +      L + + +   + V L+V    A      +++        
Sbjct: 55  QNRVVVAMSVVLNADGVVSGNLTVPFGILVSKPVRLQVDEGKAVIET-GIRTCVPAGCIV 113

Query: 136 KRSQDTVLIEEMKRGKELVVS---AKSKRGTNTRYIYSLIGLSDSLADIRKC 184
               D   +  ++ GK L ++   A             L G S++L  +   
Sbjct: 114 PIVFDKNYVAALRAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNRLIAL 165


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target185 hypothetical protein CLIBASIA_05115 [Candidatus Liberib
3dtd_A_175 Invasion-associated protein B; structural genomics 99.96
>3dtd_A (A:) Invasion-associated protein B; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.35A {Bartonella henselae} Back     alignment and structure
Probab=99.96  E-value=4.6e-29  Score=196.96  Aligned_cols=154  Identities=15%  Similarity=0.191  Sum_probs=134.1

Q ss_pred             HHHHHHHHHHHCCCHHHCCCCCEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEEEEECC
Q ss_conf             99986543321010110123775899993598716556641200023444555530579986178776103689831034
Q gi|254781121|r   24 SVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPL  103 (185)
Q Consensus        24 ~~~~~~a~a~~~~~~~~~~f~dW~v~~~~~~~~~~C~i~s~p~~~~~~~~~~~~~~~~~v~~~~~~~~~~~vs~~~gy~~  103 (185)
                      ......+.++++++...++|+||+++|.+++++++|++.|.+.       .++++.++.+.+++.++...++++..||++
T Consensus        10 ~~~~~~a~~~~~~~~~~~~f~dW~~~C~~~~~~~~C~~~q~~~-------~~~g~~~~~i~~~~~~~~~~~~~i~~P~g~   82 (175)
T 3dtd_A           10 TTKDTVATLPNGASSLTETYGLWSINCGIQEGKKVCFMHRQEV-------NDQNRVVVAMSVVLNADGVVSGNLTVPFGI   82 (175)
T ss_dssp             --------------CBCEEETTEEEEECCC---CCEEEEEEEE-------BTTCCEEEEEEEEECTTSCEEEEEEECSSB
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEEE-------CCCCCEEEEEEEEECCCCCEEEEEEEECCE
T ss_conf             8743113589987312435478638972379997789998760-------679966789999988998647999996760


Q ss_pred             CCCCCEEEEECCCCCCCCCCCEECCCCCCEECCCCCCHHHHHHHHCCCEEEEEEEC---CCCCEEEEEEECCCHHHHHHH
Q ss_conf             67772699971665554443100037874102456696789997367769999991---899889998514428999998
Q gi|254781121|r  104 DEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEMKRGKELVVSAKS---KRGTNTRYIYSLIGLSDSLAD  180 (185)
Q Consensus       104 ~~~~~v~l~Id~~~~~~~~~~~~~~~~~a~~~~~~~d~~~i~amk~G~~~~v~~~s---~~g~~~~~~~SL~GFt~A~~~  180 (185)
                      .+.+++.+.||++++. ...++..|.+.||++....|.++|++||+|++++|.++.   .+|++++++|||+||++||++
T Consensus        83 ~l~~gv~~~vD~~~~~-~~~~~~~C~~~gC~a~~~~~~~~i~amk~G~~~~v~~~~~~~~~G~~v~~~~SL~Gf~~Al~~  161 (175)
T 3dtd_A           83 LVSKPVRLQVDEGKAV-IETGIRTCVPAGCIVPIVFDKNYVAALRAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNR  161 (175)
T ss_dssp             CTTSCEEEEETTSSCE-EEECCCEEETTEEEEEEEECHHHHHHHHHCSEEEEEEEBSSTTCCEEEEEEEECTTHHHHHHH
T ss_pred             ECCCCCEEEEECCCCE-EEEEEEEECCCCEEEECCCCHHHHHHHHCCCCCEEEEEECCCCCCCEEEEEECCCCHHHHHHH
T ss_conf             6499978999769740-687668873775187705898999999718844799997468888668877832269999999


Q ss_pred             HHH-CC
Q ss_conf             873-49
Q gi|254781121|r  181 IRK-CN  185 (185)
Q Consensus       181 ~~k-c~  185 (185)
                      +++ |+
T Consensus       162 l~~~~~  167 (175)
T 3dtd_A          162 LIALQK  167 (175)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
T ss_conf             999876