254781122

254781122

putative thiamine pyrophosphokinase

GeneID in NCBI database:8210147Locus tag:CLIBASIA_05120
Protein GI in NCBI database:254781122Protein Accession:YP_003065535.1
Gene range:+(1125047, 1125715)Protein Length:222aa
Gene description:putative thiamine pyrophosphokinase
COG prediction:[H] Thiamine pyrophosphokinase
KEGG prediction:putative thiamine pyrophosphokinase; K00949 thiamine pyrophosphokinase [EC:2.7.6.2]
SEED prediction:Thiamin pyrophosphokinase (EC 2.7.6.2)
Pathway involved in KEGG:Thiamine metabolism [PATH:las00730]
Subsystem involved in SEED:Thiamin biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MSLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF
cccccEEEEEEEEEEEccccccHHHHHHHHcccEEEEEEHHHHHHHHccccccEEEEEcccccHHHHHHcccccEEEEcccccccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEEccccEEEEEccccEEEEcccccEEEEEEcccccccEEccEEEEccccEEccccEEEEEEEEcccEEEEEcccEEEEEEcccccccc
ccccHHHccccEEEEEccccccHHHHHHHcccccEEEEccHHHHHHHccccccEEEEccccccHHHHHHHccccEEEccccccccHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEccccEEEEEccccEEEEcccccEEEEEEccccccEEEEcEEEEccccccccccEEEEEcEEcccEEEEEcccEEEEEEEccccccc
mslshtnkFIDFAILLNGDIRVTNRLLCAIESCKVIaadggichasqlkvvpelwigdfdsVDRTLLQQWSSIkrifypndkdmadGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFIlvpgkhsfdlpensvfsiVCLEDIENITITGAKYTlshhslslgssravsNVVTKNLTIMLDQGLAILisrpydlqrf
mslshtnkFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKNLTIMLdqglailisrpydlqrf
MSLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTlshhslslgssRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF
***********FAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDL***
MSLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF
*SLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF
MSLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF
MSLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target222 putative thiamine pyrophosphokinase [Candidatus Liberib
315122586231 putative thiamine pyrophosphokinase [Candidatus Liberib 1 3e-92
325294090217 thiamin pyrophosphokinase [Agrobacterium sp. H13-3] Len 1 1e-50
163869168211 putative thiamine pyrophosphokinase [Bartonella triboco 1 3e-47
159185344217 hypothetical protein Atu2717 [Agrobacterium tumefaciens 1 3e-47
86359609216 hypothetical protein RHE_CH04030 [Rhizobium etli CFN 42 1 2e-46
116254336218 thiamine pyrophosphokinase [Rhizobium leguminosarum bv. 1 2e-46
163759991217 putative thiamine pyrophosphokinase [Hoeflea phototroph 1 2e-46
240851252211 thiamine pyrophosphokinase [Bartonella grahamii as4aup] 1 3e-46
241206822216 thiamine pyrophosphokinase [Rhizobium leguminosarum bv. 1 4e-46
222150139219 thiamine pyrophosphokinase [Agrobacterium vitis S4] Len 1 5e-46
>gi|315122586|ref|YP_004063075.1| putative thiamine pyrophosphokinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 231 Back     alignment and organism information
 Score =  342 bits (876), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 191/220 (86%)

Query: 3   LSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSV 62
           LSHTN  IDFA+LLNGD+++T+RLL  I+ C++IA+DGGI HA +LKVVPELWIGDFDS 
Sbjct: 12  LSHTNNPIDFAVLLNGDLQITDRLLRIIKDCRIIASDGGIAHADKLKVVPELWIGDFDST 71

Query: 63  DRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITL 122
           D TLLQQWSSIKRI Y  +KDM+DGEIA+HKAL+ GA+NIILVG+ISGQRFDYALQHITL
Sbjct: 72  DHTLLQQWSSIKRISYLPNKDMSDGEIAIHKALELGAKNIILVGAISGQRFDYALQHITL 131

Query: 123 ATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSH 182
           A   KK+NINV LTSGIEE F+L+PGKHSFD P+NS+FSIV L DI+N+TITGAKYTLS+
Sbjct: 132 AIYCKKQNINVALTSGIEECFVLIPGKHSFDFPKNSIFSIVALSDIKNLTITGAKYTLSN 191

Query: 183 HSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF 222
           +S+SLGSSR  SNV    LTI+LD G AI+ISRPYDLQRF
Sbjct: 192 YSMSLGSSRTCSNVAKDKLTIVLDHGSAIIISRPYDLQRF 231


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325294090|ref|YP_004279954.1| thiamin pyrophosphokinase [Agrobacterium sp. H13-3] Length = 217 Back     alignment and organism information
>gi|163869168|ref|YP_001610420.1| putative thiamine pyrophosphokinase [Bartonella tribocorum CIP 105476] Length = 211 Back     alignment and organism information
>gi|159185344|ref|NP_355650.2| hypothetical protein Atu2717 [Agrobacterium tumefaciens str. C58] Length = 217 Back     alignment and organism information
>gi|86359609|ref|YP_471501.1| hypothetical protein RHE_CH04030 [Rhizobium etli CFN 42] Length = 216 Back     alignment and organism information
>gi|116254336|ref|YP_770174.1| thiamine pyrophosphokinase [Rhizobium leguminosarum bv. viciae 3841] Length = 218 Back     alignment and organism information
>gi|163759991|ref|ZP_02167075.1| putative thiamine pyrophosphokinase [Hoeflea phototrophica DFL-43] Length = 217 Back     alignment and organism information
>gi|240851252|ref|YP_002972655.1| thiamine pyrophosphokinase [Bartonella grahamii as4aup] Length = 211 Back     alignment and organism information
>gi|241206822|ref|YP_002977918.1| thiamine pyrophosphokinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 216 Back     alignment and organism information
>gi|222150139|ref|YP_002551096.1| thiamine pyrophosphokinase [Agrobacterium vitis S4] Length = 219 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target222 putative thiamine pyrophosphokinase [Candidatus Liberib
COG1564212 COG1564, THI80, Thiamine pyrophosphokinase [Coenzyme me 2e-38
TIGR01378203 TIGR01378, thi_PPkinase, thiamine pyrophosphokinase 4e-36
KOG3153250 KOG3153, KOG3153, KOG3153, Thiamine pyrophosphokinase [ 1e-08
cd07995208 cd07995, TPK, Thiamine pyrophosphokinase 9e-44
pfam04263122 pfam04263, TPK_catalytic, Thiamin pyrophosphokinase, ca 4e-15
cd06376463 cd06376, PBP1_mGluR_groupIII, Ligand-binding domain of 0.004
pfam0426566 pfam04265, TPK_B1_binding, Thiamin pyrophosphokinase, v 1e-05
>gnl|CDD|31752 COG1564, THI80, Thiamine pyrophosphokinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|162328 TIGR01378, thi_PPkinase, thiamine pyrophosphokinase Back     alignment and domain information
>gnl|CDD|38363 KOG3153, KOG3153, KOG3153, Thiamine pyrophosphokinase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|153431 cd07995, TPK, Thiamine pyrophosphokinase Back     alignment and domain information
>gnl|CDD|113050 pfam04263, TPK_catalytic, Thiamin pyrophosphokinase, catalytic domain Back     alignment and domain information
>gnl|CDD|107371 cd06376, PBP1_mGluR_groupIII, Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|146743 pfam04265, TPK_B1_binding, Thiamin pyrophosphokinase, vitamin B1 binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 222 putative thiamine pyrophosphokinase [Candidatus Liberib
cd07995208 TPK Thiamine pyrophosphokinase. Thiamine pyrophosphokin 100.0
COG1564212 THI80 Thiamine pyrophosphokinase [Coenzyme metabolism] 100.0
KOG3153250 consensus 100.0
TIGR01378211 thi_PPkinase thiamine pyrophosphokinase; InterPro: IPR0 99.97
pfam04263122 TPK_catalytic Thiamin pyrophosphokinase, catalytic doma 100.0
pfam0426566 TPK_B1_binding Thiamin pyrophosphokinase, vitamin B1 bi 99.29
COG4825395 Uncharacterized membrane-anchored protein conserved in 98.56
COG1634232 Uncharacterized Rossmann fold enzyme [General function 98.09
pfam01973169 MAF_flag10 Protein of unknown function DUF115. This fam 97.72
COG2604 594 Uncharacterized protein conserved in bacteria [Function 96.8
>cd07995 TPK Thiamine pyrophosphokinase Back     alignment and domain information
>COG1564 THI80 Thiamine pyrophosphokinase [Coenzyme metabolism] Back     alignment and domain information
>KOG3153 consensus Back     alignment and domain information
>TIGR01378 thi_PPkinase thiamine pyrophosphokinase; InterPro: IPR006282 This entry represents prokaryotic and eukaryotic thiamin pyrophosphokinase, which converts thiamin (vitamin B1) into the enzyme cofactor thiamin pyrophosphate (TPP, coenzyme B1) Back     alignment and domain information
>pfam04263 TPK_catalytic Thiamin pyrophosphokinase, catalytic domain Back     alignment and domain information
>pfam04265 TPK_B1_binding Thiamin pyrophosphokinase, vitamin B1 binding domain Back     alignment and domain information
>COG4825 Uncharacterized membrane-anchored protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1634 Uncharacterized Rossmann fold enzyme [General function prediction only] Back     alignment and domain information
>pfam01973 MAF_flag10 Protein of unknown function DUF115 Back     alignment and domain information
>COG2604 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target222 putative thiamine pyrophosphokinase [Candidatus Liberib
3lm8_A222 Crystal Structure Of Thiamine Pyrophosphokinase Fro 4e-36
3cq9_A227 Crystal Structure Of The Lp_1622 Protein From Lacto 1e-34
3l8m_A212 Crystal Structure Of A Probable Thiamine Pyrophosph 1e-32
3mel_A222 Crystal Structure Of Thiamin Pyrophosphokinase Fami 2e-32
1ig3_A263 Mouse Thiamin Pyrophosphokinase Complexed With Thia 1e-30
3k94_A223 Crystal Structure Of Thiamin Pyrophosphokinase From 1e-30
3ihk_A218 Crystal Structure Of Thiamin Pyrophosphokinase From 6e-26
2omk_A231 Structure Of The Bacteroides Thetaiotaomicron Thiam 3e-24
2g9z_A348 Thiamin Pyrophosphokinase From Candida Albicans Len 2e-17
2hh9_A339 Thiamin Pyrophosphokinase From Candida Albicans Len 4e-17
1ig0_A319 Crystal Structure Of Yeast Thiamin Pyrophosphokinas 3e-10
>gi|291463669|pdb|3LM8|A Chain A, Crystal Structure Of Thiamine Pyrophosphokinase From Bacillus Subtilis, Northeast Structural Genomics Consortium Target Sr677 Length = 222 Back     alignment and structure
 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 58/217 (26%), Positives = 94/217 (43%), Gaps = 8/217 (3%)

Query: 10  IDFAILLNGDIRVTNRLLCAIES-CKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQ 68
               I+  G   +   L    +     I  D G        ++P    GDFDS+     +
Sbjct: 2   KTINIVAGGPKNLIPDLTGYTDEHTLWIGVDKGTVTLLDAGIIPVEAFGDFDSITEQERR 61

Query: 69  QWSS--IKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSL 126
           +          Y  +KD  D ++A+  AL+    +II +  I+G R D+ L +I L    
Sbjct: 62  RIEKAAPALHVYQAEKDQTDLDLALDWALEKQP-DIIQIFGITGGRADHFLGNIQLLYKG 120

Query: 127 KKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFS--IVCLEDIENITITGAKYTLSHHS 184
            K NI + L      +    PG++  +  EN  +   I   EDI  +T+TG KY L++  
Sbjct: 121 VKTNIKIRLIDKQNHIQXFPPGEYDIEKDENKRYISFIPFSEDIHELTLTGFKYPLNNCH 180

Query: 185 LSLGSSRAVSNV-VTKNLTIMLDQGLAILISRPYDLQ 220
           ++LGS+  +SN  +    T    +G+ I I R  DL+
Sbjct: 181 ITLGSTLCISNELIHSRGTFSFVKGILIXI-RSTDLE 216


>gi|183448394|pdb|3CQ9|A Chain A, Crystal Structure Of The Lp_1622 Protein From Lactobacillus Plantarum. Northeast Structural Genomics Consortium Target Lpr114 Length = 227 Back     alignment and structure
>gi|288563182|pdb|3L8M|A Chain A, Crystal Structure Of A Probable Thiamine Pyrophosphokinase From Staphylococcus Saprophyticus Subsp. Saprophyticus. Northeast Structural Genomics Consortium Target Id Syr86 Length = 212 Back     alignment and structure
>gi|295789541|pdb|3MEL|A Chain A, Crystal Structure Of Thiamin Pyrophosphokinase Family Protei Enterococcus Faecalis, Northeast Structural Genomics Consor Target Efr150 Length = 222 Back     alignment and structure
>gi|14278354|pdb|1IG3|A Chain A, Mouse Thiamin Pyrophosphokinase Complexed With Thiamin Length = 263 Back     alignment and structure
>gi|288563054|pdb|3K94|A Chain A, Crystal Structure Of Thiamin Pyrophosphokinase From Geobacillus Thermodenitrificans, Northeast Structural Genomics Consortium Target Gtr2 Length = 223 Back     alignment and structure
>gi|256599912|pdb|3IHK|A Chain A, Crystal Structure Of Thiamin Pyrophosphokinase From S.Mutans, Northeast Structural Genomics Consortium Target Smr83 Length = 218 Back     alignment and structure
>gi|126031666|pdb|2OMK|A Chain A, Structure Of The Bacteroides Thetaiotaomicron Thiamin Pyrophosphokinase Length = 231 Back     alignment and structure
>gi|93279942|pdb|2G9Z|A Chain A, Thiamin Pyrophosphokinase From Candida Albicans Length = 348 Back     alignment and structure
>gi|112491350|pdb|2HH9|A Chain A, Thiamin Pyrophosphokinase From Candida Albicans Length = 339 Back     alignment and structure
gi|14719681|pdb|1IG0|A Chain A, Crystal Structure Of Yeast Thiamin Pyrophosphokinase Length = 319 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target222 putative thiamine pyrophosphokinase [Candidatus Liberib
3lm8_A222 Thiamine pyrophosphokinase; structural genomics, PSI-2, 5e-35
3l8m_A212 Probable thiamine pyrophosphokinase; thiamin diphosphat 1e-33
1ig3_A263 Thiamin pyrophosphokinase; beta barrel, alpha/beta/alph 1e-30
3mel_A222 Thiamin pyrophosphokinase family protein; structural ge 3e-30
3cq9_A227 Uncharacterized protein LP_1622; Q88WK7_lacpl, transfer 1e-29
3k94_A223 Thiamin pyrophosphokinase; structural genomics, PSI-2, 4e-29
3ihk_A218 Thiamin pyrophosphokinase; structural genomics, PSI-2, 2e-28
2omk_A231 Hypothetical protein; succinimide, thiamin pyrophosphok 3e-26
2g9z_A348 Thiamine pyrophosphokinase; thiamin-PNP, TPK, thiamin p 1e-22
1ig0_A319 Thiamin pyrophosphokinase; protein-substrate complex, c 1e-14
>3lm8_A Thiamine pyrophosphokinase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: VIB; 2.60A {Bacillus subtilis} Length = 222 Back     alignment and structure
 Score =  142 bits (360), Expect = 5e-35
 Identities = 58/215 (26%), Positives = 96/215 (44%), Gaps = 8/215 (3%)

Query: 12  FAILLNGDIRVTNRLLCAIESCK-VIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQW 70
             I+  G   +   L    +     I  D G        ++P    GDFDS+     ++ 
Sbjct: 4   INIVAGGPKNLIPDLTGYTDEHTLWIGVDKGTVTLLDAGIIPVEAFGDFDSITEQERRRI 63

Query: 71  SS--IKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKK 128
                    Y  +KD  D ++A+  AL+     I + G I+G R D+ L +I L     K
Sbjct: 64  EKAAPALHVYQAEKDQTDLDLALDWALEKQPDIIQIFG-ITGGRADHFLGNIQLLYKGVK 122

Query: 129 KNINVTLTSGIEEVFILVPGKHSFDLPENS--VFSIVCLEDIENITITGAKYTLSHHSLS 186
            NI + L      + +  PG++  +  EN   +  I   EDI  +T+TG KY L++  ++
Sbjct: 123 TNIKIRLIDKQNHIQMFPPGEYDIEKDENKRYISFIPFSEDIHELTLTGFKYPLNNCHIT 182

Query: 187 LGSSRAVSNVVTKN-LTIMLDQGLAILISRPYDLQ 220
           LGS+  +SN +  +  T    +G+ I+I R  DL+
Sbjct: 183 LGSTLCISNELIHSRGTFSFVKGILIMI-RSTDLE 216


>3l8m_A Probable thiamine pyrophosphokinase; thiamin diphosphate biosynthetic process, ATP binding, structural genomics, PSI-2; 2.40A {Staphylococcus saprophyticus} Length = 212 Back     alignment and structure
>1ig3_A Thiamin pyrophosphokinase; beta barrel, alpha/beta/alpha sandwich, transferase; HET: VIB; 1.90A {Mus musculus} SCOP: b.82.6.1 c.100.1.1 PDB: 2f17_A* Length = 263 Back     alignment and structure
>3mel_A Thiamin pyrophosphokinase family protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium; HET: TPP; 2.79A {Enterococcus faecalis} Length = 222 Back     alignment and structure
>3cq9_A Uncharacterized protein LP_1622; Q88WK7_lacpl, transferase, thiamine pyrophosphokinase, NESG, LPR114, structural genomics, PSI-2; 2.20A {Lactobacillus plantarum WCFS1} Length = 227 Back     alignment and structure
>3k94_A Thiamin pyrophosphokinase; structural genomics, PSI-2, protein structure initiative; 2.10A {Geobacillus thermodenitrificans ng80-2} Length = 223 Back     alignment and structure
>3ihk_A Thiamin pyrophosphokinase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, SMR83; HET: TPP; 3.00A {Streptococcus mutans} Length = 218 Back     alignment and structure
>2omk_A Hypothetical protein; succinimide, thiamin pyrophosphokinase, structural genomics, PSI-2, protein structure initiative; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Length = 231 Back     alignment and structure
>2g9z_A Thiamine pyrophosphokinase; thiamin-PNP, TPK, thiamin pyrophosphokinase, structural genomics, profun, bacterial targets at IGS-CNRS, france; HET: VNP; 1.96A {Candida albicans} PDB: 2hh9_A* Length = 348 Back     alignment and structure
>1ig0_A Thiamin pyrophosphokinase; protein-substrate complex, compound active site, alpha-beta- alpha, beta sandwich, transferase; HET: VIB; 1.80A {Saccharomyces cerevisiae} SCOP: b.82.6.1 c.100.1.1 Length = 319 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target222 putative thiamine pyrophosphokinase [Candidatus Liberib
3lm8_A222 Thiamine pyrophosphokinase; structural genomics, PSI-2, 100.0
3l8m_A212 Probable thiamine pyrophosphokinase; thiamin diphosphat 100.0
3k94_A223 Thiamin pyrophosphokinase; structural genomics, PSI-2, 100.0
2omk_A231 Hypothetical protein; succinimide, thiamin pyrophosphok 100.0
3mel_A222 Thiamin pyrophosphokinase family protein; structural ge 100.0
3ihk_A218 Thiamin pyrophosphokinase; structural genomics, PSI-2, 100.0
2g9z_A348 Thiamine pyrophosphokinase; thiamin-PNP, TPK, thiamin p 100.0
1ig3_A263 Thiamin pyrophosphokinase; beta barrel, alpha/beta/alph 100.0
3cq9_A227 Uncharacterized protein LP_1622; Q88WK7_lacpl, transfer 100.0
1ig0_A319 Thiamin pyrophosphokinase; protein-substrate complex, c 100.0
1zxx_A 319 6-phosphofructokinase; allosteric regulation, lactobaci 90.72
3pfk_A 319 Phosphofructokinase; transferase(phosphotransferase); 2 90.18
>3lm8_A Thiamine pyrophosphokinase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: VIB; 2.60A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=0  Score=379.20  Aligned_cols=211  Identities=26%  Similarity=0.365  Sum_probs=189.5

Q ss_pred             CEEEEEEECCCCCCCHHHHHHHC-CCCEEEEEHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHCC--CCEEEECCCCCCC
Q ss_conf             40699998779998168898513-49499991888999988997349997211299889974031--8859920567779
Q gi|254781122|r    9 FIDFAILLNGDIRVTNRLLCAIE-SCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSS--IKRIFYPNDKDMA   85 (222)
Q Consensus         9 ~~~~~Ii~nG~~~~~~~~~~~~~-~~~iIavDgGa~~l~~~~i~Pd~iiGDfDSi~~~~~~~~~~--~~~i~~~~dkD~T   85 (222)
                      |..++|++||+.+..+.+...++ .+++||||||+++|+++|+.||++||||||++++.+++++.  ..++++|+|||+|
T Consensus         1 Mk~i~IvagG~~~~~~~l~~~~~~~~~vIaaDgG~~~l~~~gi~Pd~iiGDfDSi~~~~~~~~~~~~~~i~~~~~dkD~T   80 (222)
T 3lm8_A            1 MKTINIVAGGPKNLIPDLTGYTDEHTLWIGVDKGTVTLLDAGIIPVEAFGDFDSITEQERRRIEKAAPALHVYQAEKDQT   80 (222)
T ss_dssp             -CEEEEECSSCGGGSCCSGGGCCTTEEEEEETHHHHHHHHHTCCCSEEESCSTTSCHHHHHHHHHHCTTCEEECCCSSSC
T ss_pred             CCEEEEEECCCCCCCHHHHHHCCCCCEEEEECCHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCEEECCHHHCCC
T ss_conf             96999998999766776886314488899984189999977998698972688997578789985498359958453658


Q ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCEEEEEECCCEEEEE-CCCEEEEEEE
Q ss_conf             489999999975997599995378781247889999999886269819999489189999679569970-5980899975
Q gi|254781122|r   86 DGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDL-PENSVFSIVC  164 (222)
Q Consensus        86 D~ekAL~~~~~~~~~~i~i~gg~~G~R~DH~lani~~L~~~~~~~~~i~l~~~~~~i~~l~~g~~~~~~-~~g~~~Sl~p  164 (222)
                      |+||||++|.++++++++++|| +|||+||+|+|+++|+++.+.+++++++++++.++++.+|++.+.. +.++++||+|
T Consensus        81 D~ekAl~~~~~~~~~~i~i~Ga-~GgR~DH~lani~~L~~~~~~~~~i~l~~~~~~i~~l~~g~~~~~~~~~~~~iSl~p  159 (222)
T 3lm8_A           81 DLDLALDWALEKQPDIIQIFGI-TGGRADHFLGNIQLLYKGVKTNIKIRLIDKQNHIQMFPPGEYDIEKDENKRYISFIP  159 (222)
T ss_dssp             HHHHHHHHHHHHCCSEEEEESC-CCSCHHHHHHHHHHHHHHHHTTCEEEEEETTEEEEEECSEEEEEECCSSCCEEEEEE
T ss_pred             HHHHHHHHHHHCCCCEEEEEEC-CCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCEEEEEECCCEEEEECCCCCEEEEEE
T ss_conf             8999999999749998999902-479656889999999988756975999969949999928966998058985799998


Q ss_pred             CC-CCCEEEEECEEEECCCCEECCCCCEEEEEEECCC-EEEEEECCEEEEEECCCCCCC
Q ss_conf             15-7762573041665378785278753884998495-799995790999974410024
Q gi|254781122|r  165 LE-DIENITITGAKYTLSHHSLSLGSSRAVSNVVTKN-LTIMLDQGLAILISRPYDLQR  221 (222)
Q Consensus       165 ~~-~~~~vt~~Glky~L~~~~l~~~~~~~~SN~~~~~-~~I~~~~G~llvi~~~kd~~~  221 (222)
                      ++ ++++||++||||||++++|++++++|+||++.++ ++|++++|.+++| +|||++.
T Consensus       160 l~~~~~~vt~~Glky~L~~~~l~~~~~~g~SNe~~~~~~~I~~~~G~llvi-~s~D~~~  217 (222)
T 3lm8_A          160 FSEDIHELTLTGFKYPLNNCHITLGSTLCISNELIHSRGTFSFVKGILIMI-RSTDLEH  217 (222)
T ss_dssp             CSSCEEEEEEESBSSCEEEEEECTTCCTTSSBCBSSSEEEEEESBSCEEEE-EECCC--
T ss_pred             CCCCCCEEEECCCEEECCCCEEECCCCEEEEEEEECCEEEEEECCCEEEEE-EEECCCC
T ss_conf             468722599359897779927627995078379989849999878989999-9264764



>3l8m_A Probable thiamine pyrophosphokinase; thiamin diphosphate biosynthetic process, ATP binding, structural genomics, PSI-2; 2.40A {Staphylococcus saprophyticus} Back     alignment and structure
>3k94_A Thiamin pyrophosphokinase; structural genomics, PSI-2, protein structure initiative; 2.10A {Geobacillus thermodenitrificans ng80-2} Back     alignment and structure
>2omk_A Hypothetical protein; succinimide, thiamin pyrophosphokinase, structural genomics, PSI-2, protein structure initiative; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3mel_A Thiamin pyrophosphokinase family protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium; HET: TPP; 2.79A {Enterococcus faecalis} Back     alignment and structure
>3ihk_A Thiamin pyrophosphokinase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, SMR83; HET: TPP; 3.00A {Streptococcus mutans} Back     alignment and structure
>2g9z_A Thiamine pyrophosphokinase; thiamin-PNP, TPK, thiamin pyrophosphokinase, structural genomics, profun, bacterial targets at IGS-CNRS, france; HET: VNP; 1.96A {Candida albicans} PDB: 2hh9_A* Back     alignment and structure
>1ig3_A Thiamin pyrophosphokinase; beta barrel, alpha/beta/alpha sandwich, transferase; HET: VIB; 1.90A {Mus musculus} SCOP: b.82.6.1 c.100.1.1 PDB: 2f17_A* Back     alignment and structure
>3cq9_A Uncharacterized protein LP_1622; Q88WK7_lacpl, transferase, thiamine pyrophosphokinase, NESG, LPR114, structural genomics, PSI-2; 2.20A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ig0_A Thiamin pyrophosphokinase; protein-substrate complex, compound active site, alpha-beta- alpha, beta sandwich, transferase; HET: VIB; 1.80A {Saccharomyces cerevisiae} SCOP: b.82.6.1 c.100.1.1 Back     alignment and structure
>1zxx_A 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3pfk_A Phosphofructokinase; transferase(phosphotransferase); 2.40A {Geobacillus stearothermophilus} SCOP: c.89.1.1 PDB: 4pfk_A* 6pfk_A 1mto_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 222 putative thiamine pyrophosphokinase [Candidatus Liberib
d1ig3a2169 c.100.1.1 (A:10-178) Thiamin pyrophosphokinase, catalyt 2e-13
d1ig0a2221 c.100.1.1 (A:3-223) Thiamin pyrophosphokinase, catalyti 3e-08
d1ig3a185 b.82.6.1 (A:179-263) Thiamin pyrophosphokinase, substra 4e-07
>d1ig3a2 c.100.1.1 (A:10-178) Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin pyrophosphokinase, catalytic domain
superfamily: Thiamin pyrophosphokinase, catalytic domain
family: Thiamin pyrophosphokinase, catalytic domain
domain: Thiamin pyrophosphokinase, catalytic domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 69.6 bits (170), Expect = 2e-13
 Identities = 26/140 (18%), Positives = 53/140 (37%), Gaps = 20/140 (14%)

Query: 14  ILLNGDIRVTNRLLCAI--ESCKVIAADGGICHASQL------KVVPELWIGDFDSVDRT 65
           ++LN  +   +     +  ++     ADGG  H   L        +PE   GDFDS+   
Sbjct: 33  VVLNQPL---DARFRHLWKKALLRACADGGANHLYDLTEGERESFLPEFVSGDFDSIRPE 89

Query: 66  LLQQWSS-IKRIFYPNDKDMADGEIAVH------KALQSGARNIILVGSISGQRFDYALQ 118
           + + ++     +    D+D  D    +       +  +     I+ +G + G RFD  + 
Sbjct: 90  VKEYYTKKGCDLISTPDQDHTDFTKCLQVLQRKIEEKELQVDVIVTLGGLGG-RFDQIMA 148

Query: 119 HI-TLATSLKKKNINVTLTS 137
            + TL  +     + + +  
Sbjct: 149 SVNTLFQATHITPVPIIIIQ 168


>d1ig0a2 c.100.1.1 (A:3-223) Thiamin pyrophosphokinase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 Back     information, alignment and structure
>d1ig3a1 b.82.6.1 (A:179-263) Thiamin pyrophosphokinase, substrate-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target222 putative thiamine pyrophosphokinase [Candidatus Liberib
d1ig3a2169 Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus 100.0
d1ig0a2221 Thiamin pyrophosphokinase, catalytic domain {Baker's ye 99.98
d1ig3a185 Thiamin pyrophosphokinase, substrate-binding domain {Mo 99.38
d1ig0a196 Thiamin pyrophosphokinase, substrate-binding domain {Ba 98.84
>d1ig3a2 c.100.1.1 (A:10-178) Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin pyrophosphokinase, catalytic domain
superfamily: Thiamin pyrophosphokinase, catalytic domain
family: Thiamin pyrophosphokinase, catalytic domain
domain: Thiamin pyrophosphokinase, catalytic domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=2.2e-32  Score=222.81  Aligned_cols=130  Identities=20%  Similarity=0.299  Sum_probs=109.4

Q ss_pred             CCCCEEEEEEECCCCCCCHHHHHHHCC-CCEEEEEHHHHHHHHC------CCCCEEEEECCCCCCHHHHHHHCCCC-EEE
Q ss_conf             287406999987799981688985134-9499991888999988------99734999721129988997403188-599
Q gi|254781122|r    6 TNKFIDFAILLNGDIRVTNRLLCAIES-CKVIAADGGICHASQL------KVVPELWIGDFDSVDRTLLQQWSSIK-RIF   77 (222)
Q Consensus         6 ~~~~~~~~Ii~nG~~~~~~~~~~~~~~-~~iIavDgGa~~l~~~------~i~Pd~iiGDfDSi~~~~~~~~~~~~-~i~   77 (222)
                      +.+++.++|++|++++  +.+...|+. ..+||||||||+++++      ++.||+|+|||||++++.+++++..+ .++
T Consensus        25 ~~~~~~aliiLN~pi~--~~~~~lw~~a~~~I~aDGGAN~L~d~~~~~~~~~~PD~IiGDfDSi~~~~~~~~~~~g~~ii  102 (169)
T d1ig3a2          25 TGNLKYCLVVLNQPLD--ARFRHLWKKALLRACADGGANHLYDLTEGERESFLPEFVSGDFDSIRPEVKEYYTKKGCDLI  102 (169)
T ss_dssp             SCCCCEEEEECSSCCC--TTHHHHHHHCSEEEEETTHHHHHHHTCTTCGGGCCCSEEEECTTSSCHHHHHHHHHTTCEEE
T ss_pred             CCCCCEEEEEECCCCC--HHHHHHHHHCCEEEEECCHHHHHHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHCCCEEE
T ss_conf             8874779999089848--88999997478799974779999987532023799998976688898578899986597587


Q ss_pred             ECCCCCCCHHHHHHHHHHHC------CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC-CEEEEEEC
Q ss_conf             20567779489999999975------997599995378781247889999999886269-81999948
Q gi|254781122|r   78 YPNDKDMADGEIAVHKALQS------GARNIILVGSISGQRFDYALQHITLATSLKKKN-INVTLTSG  138 (222)
Q Consensus        78 ~~~dkD~TD~ekAL~~~~~~------~~~~i~i~gg~~G~R~DH~lani~~L~~~~~~~-~~i~l~~~  138 (222)
                      +.+|||+|||||||+++.+.      ++..++++|| +|||+||+|+|+++|+++.+.. .+++++++
T Consensus       103 ~~~dQD~TD~eKAl~~~~~~~~~~~~~~~~I~vlG~-~GGR~DH~lanl~~L~~~~~~~~~~VIll~e  169 (169)
T d1ig3a2         103 STPDQDHTDFTKCLQVLQRKIEEKELQVDVIVTLGG-LGGRFDQIMASVNTLFQATHITPVPIIIIQK  169 (169)
T ss_dssp             ECCCTTSCHHHHHHHHHHHHHHHTTCCCSEEEEECC-SSSCHHHHHHHHHHHHHGGGTCSSCEEEEET
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEC-CCCCHHHHHHHHHHHHHHHCCCCCCEEEECC
T ss_conf             786657566999999999741443169987999927-8882879999999999702479984798359



>d1ig0a2 c.100.1.1 (A:3-223) Thiamin pyrophosphokinase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ig3a1 b.82.6.1 (A:179-263) Thiamin pyrophosphokinase, substrate-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig0a1 b.82.6.1 (A:224-319) Thiamin pyrophosphokinase, substrate-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 222 putative thiamine pyrophosphokinase [Candidatus Li
3k94_A_223 (A:) Thiamin pyrophosphokinase; structural genomic 2e-32
3l8m_A_212 (A:) Probable thiamine pyrophosphokinase; thiamin 4e-31
3ihk_A_218 (A:) Thiamin pyrophosphokinase; structural genomic 1e-30
2omk_A_231 (A:) Hypothetical protein; succinimide, thiamin py 2e-30
1ig3_A_263 (A:) Thiamin pyrophosphokinase; beta barrel, alpha 2e-29
3cq9_A_227 (A:) Uncharacterized protein LP_1622; Q88WK7_lacpl 5e-27
1ig0_A_319 (A:) Thiamin pyrophosphokinase; protein-substrate 2e-25
2g9z_A_348 (A:) Thiamine pyrophosphokinase; thiamin-PNP, TPK, 1e-22
>3k94_A (A:) Thiamin pyrophosphokinase; structural genomics, PSI-2, protein structure initiative; 2.10A {Geobacillus thermodenitrificans ng80-2}Length = 223 Back     alignment and structure
 Score =  133 bits (335), Expect = 2e-32
 Identities = 49/206 (23%), Positives = 86/206 (41%), Gaps = 9/206 (4%)

Query: 14  ILLNGDIRVTNRLLCAI-ESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSS 72
           I+  G   +   L     E    +  D G     +    P    GDFDS+    + +   
Sbjct: 5   IVGGGPRELLPDLRFYDGEDVXWVGVDRGTXTLLEAGFRPVRAFGDFDSLPAEDVVKLQQ 64

Query: 73  --IKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKN 130
                  +P +KD  D EIA+  A++  AR I L G+  G R D+   ++ L   LK  +
Sbjct: 65  AFPDLDVWPAEKDKTDXEIALDWAVEQTARXIRLFGATGG-RLDHLFGNVELL--LKYAD 121

Query: 131 INVTLTSGIEEVFILVPGKHSF-DLPENSVFSIV-CLEDIENITITGAKYTLSHHSLSLG 188
             + +      + + +PG ++          S +   E +   T+TG KY L++  +S G
Sbjct: 122 RPIEIVDRQNVLTVHLPGTYTVXYDARYCYVSYIPVSETVAEFTLTGFKYPLTNXHISRG 181

Query: 189 SSRAVSNVVTKN-LTIMLDQGLAILI 213
           S+  +SN + ++  T    +G+   I
Sbjct: 182 STLXISNELIQSSGTFSFSEGILXXI 207


>3l8m_A (A:) Probable thiamine pyrophosphokinase; thiamin diphosphate biosynthetic process, ATP binding, structural genomics, PSI-2; 2.40A {Staphylococcus saprophyticus}Length = 212 Back     alignment and structure
>3ihk_A (A:) Thiamin pyrophosphokinase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, SMR83; HET: TPP; 3.00A {Streptococcus mutans}Length = 218 Back     alignment and structure
>2omk_A (A:) Hypothetical protein; succinimide, thiamin pyrophosphokinase, structural genomics, PSI-2, protein structure initiative; 1.80A {Bacteroides thetaiotaomicron vpi-5482}Length = 231 Back     alignment and structure
>1ig3_A (A:) Thiamin pyrophosphokinase; beta barrel, alpha/beta/alpha sandwich, transferase; HET: VIB; 1.90A {Mus musculus}Length = 263 Back     alignment and structure
>3cq9_A (A:) Uncharacterized protein LP_1622; Q88WK7_lacpl, transferase, thiamine pyrophosphokinase, NESG, LPR114, structural genomics, PSI-2; 2.20A {Lactobacillus plantarum WCFS1}Length = 227 Back     alignment and structure
>1ig0_A (A:) Thiamin pyrophosphokinase; protein-substrate complex, compound active site, alpha-beta- alpha, beta sandwich, transferase; HET: VIB; 1.80A {Saccharomyces cerevisiae}Length = 319 Back     alignment and structure
>2g9z_A (A:) Thiamine pyrophosphokinase; thiamin-PNP, TPK, thiamin pyrophosphokinase, structural genomics, profun, bacterial targets at IGS-CNRS, france; HET: VNP; 1.96A {Candida albicans} PDB: 2hh9_A*Length = 348 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target222 putative thiamine pyrophosphokinase [Candidatus Liberib
2omk_A_231 Hypothetical protein; succinimide, thiamin pyropho 100.0
3k94_A_223 Thiamin pyrophosphokinase; structural genomics, PS 100.0
1ig3_A_263 Thiamin pyrophosphokinase; beta barrel, alpha/beta 100.0
3l8m_A_212 Probable thiamine pyrophosphokinase; thiamin dipho 100.0
3ihk_A_218 Thiamin pyrophosphokinase; structural genomics, PS 100.0
3cq9_A_227 Uncharacterized protein LP_1622; Q88WK7_lacpl, tra 100.0
1ig0_A_319 Thiamin pyrophosphokinase; protein-substrate compl 100.0
2g9z_A_348 Thiamine pyrophosphokinase; thiamin-PNP, TPK, thia 100.0
>2omk_A (A:) Hypothetical protein; succinimide, thiamin pyrophosphokinase, structural genomics, PSI-2, protein structure initiative; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
Probab=100.00  E-value=0  Score=357.77  Aligned_cols=202  Identities=22%  Similarity=0.261  Sum_probs=185.6

Q ss_pred             CCCCEEEEEEECCCCCCCHHHHHHHCC-CCEEEEEHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHCCCCEEEECCCCCC
Q ss_conf             287406999987799981688985134-9499991888999988997349997211299889974031885992056777
Q gi|254781122|r    6 TNKFIDFAILLNGDIRVTNRLLCAIES-CKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDM   84 (222)
Q Consensus         6 ~~~~~~~~Ii~nG~~~~~~~~~~~~~~-~~iIavDgGa~~l~~~~i~Pd~iiGDfDSi~~~~~~~~~~~~~i~~~~dkD~   84 (222)
                      ..+|++++|++||+.+..+++.+.++. +++|||||||++|+++|++||++||||||++++.+++++..  +++|||||+
T Consensus        28 ~~~~~~~~Iv~ng~~~~~~~~~~~~~~~~~~IavDgGa~~l~~~gi~Pd~iiGDfDSi~~e~~~~~~~~--~~~~~~KD~  105 (231)
T 2omk_A           28 EHYIPQAIILANGEYPAHELPLRLLAEAQFVVCCXXAANEYISRGHTPDVIIGDGDSLLPEYKKRFSSI--ILQISDQET  105 (231)
T ss_dssp             CCCCCSEEEECSSSCCCSHHHHHHHHHCSCEEEC--CHHHHHHTTCCCSEEESCGGGSCHHHHHHHGGG--EECCCSSCC
T ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHCCEEEEEHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHCCEE--EECCCCCCC
T ss_conf             578988899989989970889999866998999879999999879973699704110598788634606--644778786


Q ss_pred             CHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCEEEEEECCCEEEEECCCEEEEEEE
Q ss_conf             94899999999759975999953787812478899999998862698199994891899996795699705980899975
Q gi|254781122|r   85 ADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVC  164 (222)
Q Consensus        85 TD~ekAL~~~~~~~~~~i~i~gg~~G~R~DH~lani~~L~~~~~~~~~i~l~~~~~~i~~l~~g~~~~~~~~g~~~Sl~p  164 (222)
                      ||+||||++|.++++++++++|| +|||+||+|+|+++|+++.+++.+++++++++.++++++| ..+..++|+++|++|
T Consensus       106 TD~e~Al~~~~~~~~~~i~i~Ga-~GgR~DH~lani~~l~~~~~~~~~i~l~~~~~~i~~l~~g-~~~~~~~g~~~Slip  183 (231)
T 2omk_A          106 NDQTKAVHYLQSKGIRKIAIVGA-TGKREDHTLGNISLLVEYMRSGMEVRTVTDYGTFIPVSDT-QSFASYPGQQVSIIN  183 (231)
T ss_dssp             CHHHHHHHHHHHTTCCEEEEESC-SSSCHHHHHHHHHHHHHHHHTTCEEEEECSSEEEEEEESS-EEEECCTTCEEEEEE
T ss_pred             CHHHHHHHHHHHCCCCEEEEECC-CCCCHHHHHHHHHHHHHHHHCCCEEEEECCCEEEEEECCC-CCCCCCCCCEEEEEE
T ss_conf             76999999987579987999658-8996748999999999999749759993476599996894-122358997874320


Q ss_pred             CCCCCEEEEECEEEECCCCEECCCCCEEEEEEECCC-EEEEEECCEEEEEEC
Q ss_conf             157762573041665378785278753884998495-799995790999974
Q gi|254781122|r  165 LEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKN-LTIMLDQGLAILISR  215 (222)
Q Consensus       165 ~~~~~~vt~~Glky~L~~~~l~~~~~~~~SN~~~~~-~~I~~~~G~llvi~~  215 (222)
                      +++ ++||++||||||++++|+++   |+||++.++ ++|++++|.+++|.+
T Consensus       184 l~~-~~vt~~Glky~L~~~~l~~~---~~SN~~~~~~v~I~~~~G~ll~i~~  231 (231)
T 2omk_A          184 FGA-KGLKAEGLFYPLSDFTNWWQ---GTLNEAIADEFTIHCTGEYLVFLAY  231 (231)
T ss_dssp             EEE-EEEEEESBSSCCCCCSSGGG---GTTEEBCSSEEEEEEEEEEEEEEEC
T ss_pred             CCC-CEEEEECCEEECCCCCCCCC---CEEEEEECCEEEEEECCCEEEEEEC
T ss_conf             457-74997488857789877889---8778998987999985999999969



>3k94_A (A:) Thiamin pyrophosphokinase; structural genomics, PSI-2, protein structure initiative; 2.10A {Geobacillus thermodenitrificans ng80-2} Back     alignment and structure
>1ig3_A (A:) Thiamin pyrophosphokinase; beta barrel, alpha/beta/alpha sandwich, transferase; HET: VIB; 1.90A {Mus musculus} Back     alignment and structure
>3l8m_A (A:) Probable thiamine pyrophosphokinase; thiamin diphosphate biosynthetic process, ATP binding, structural genomics, PSI-2; 2.40A {Staphylococcus saprophyticus} Back     alignment and structure
>3ihk_A (A:) Thiamin pyrophosphokinase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, SMR83; HET: TPP; 3.00A {Streptococcus mutans} Back     alignment and structure
>3cq9_A (A:) Uncharacterized protein LP_1622; Q88WK7_lacpl, transferase, thiamine pyrophosphokinase, NESG, LPR114, structural genomics, PSI-2; 2.20A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ig0_A (A:) Thiamin pyrophosphokinase; protein-substrate complex, compound active site, alpha-beta- alpha, beta sandwich, transferase; HET: VIB; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2g9z_A (A:) Thiamine pyrophosphokinase; thiamin-PNP, TPK, thiamin pyrophosphokinase, structural genomics, profun, bacterial targets at IGS-CNRS, france; HET: VNP; 1.96A {Candida albicans} PDB: 2hh9_A* Back     alignment and structure