254781125

254781125

hypothetical protein CLIBASIA_05135

GeneID in NCBI database:8210150Locus tag:CLIBASIA_05135
Protein GI in NCBI database:254781125Protein Accession:YP_003065538.1
Gene range:-(1128350, 1128529)Protein Length:59aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------6
MSPILEYIRCLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRSYML
ccHHHHHHHHcccccEEEEccccccEEEEEEcccHHHHHHHHcccHHHHHHHHHHHHHc
cccHHHHHHHccccccEEEEccccccEEEEEcccccEEEEEccccccHHHHHHHHHHcc
mspileyirclndpnryrlsakdphynvifrdevpsfiyetlnipadkrKMAVIRSYML
MSPILEYIRClndpnryrlsakdphynvifRDEVPSFIYEtlnipadkrkmAVIRSYML
MSPILEYIRCLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRSYML
**PILEYIRCLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRSYML
MSPILEYIRCLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRSYML
*SPILEYIRCLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRSYML
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPILEYIRCLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIRSYML

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target59 hypothetical protein CLIBASIA_05135 [Candidatus Liberib
254781189252 hypothetical protein CLIBASIA_05480 [Candidatus Li 0.002
>gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Back     alignment
 Score = 32.0 bits (71), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 6   EYIRCLNDPNRYRL--SAKDPHYNVIFRDEVPSFIYETLNIPADKRKM 51
           E   CL   +RY +  +   P Y VI    VP FI++ L+IP +KR++
Sbjct: 109 EACACLTQYDRYEVIYNFGGPMYGVI----VPDFIHDLLDIPEEKRRL 152

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00