254781124

254781124

hypothetical protein CLIBASIA_05130

GeneID in NCBI database:8210149Locus tag:CLIBASIA_05130
Protein GI in NCBI database:254781124Protein Accession:YP_003065537.1
Gene range:-(1128048, 1128353)Protein Length:101aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MNPHGLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLENRSNHQTKNDINKCVLSEEFTIQNNKGK
ccccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEccccc
ccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccHHHHHHHHHHHHHHcccccccccccHcEEccEEEEEccccc
mnphglmyapkegnqyrplrKEVRNAFPKILKSIEKALepyvdpliepveigkegmvdegYRLHICALIKLLENrsnhqtkndinkcvlseeftiqnnkgk
mnphglmyapkegnqyrplRKEVRNAFPKILKSIEkalepyvdpLIEPVEIGKEGMVDEGYRLHICALIKLLenrsnhqtkndinkcvlseeftiqnnkgk
MNPHGLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLENRSNHQTKNDINKCVLSEEFTIQNNKGK
******M*****************NAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLE********NDINKCVLSEEF*I******
MNPHGLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLENRSNHQTKNDINKCVLSEEFTIQNNKGK
****GLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLENRSNHQTKNDINKCVLSEEFTIQNN***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPHGLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLENRSNHQTKNDINKCVLSEEFTIQNNKGK
MNPHGLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLENRSNHQTKNDINKCVLSEEFTIQNNKGK
MNPHGLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLENRSNHQTKNDINKCVLSEEFTIQNNKGK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target101 hypothetical protein CLIBASIA_05130 [Candidatus Liberib
25478020382 hypothetical protein CLIBASIA_00440 [Candidatus Li 3e-10
>gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Back     alignment
 Score = 55.1 bits (131), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 12 EGNQYRPLRKEVRNAFPKILKSIEKALEPY-VDPLIEPVEIGKEGMVDEGYRLHICALIK 70
          +  +YRP ++EVR+AFP+++K++EK L  + V+PL  PV+   +G   E Y  H+C LI+
Sbjct: 2  DDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGY--ESYISHVCELIE 59

Query: 71 LLENRS 76
          LL+N+ 
Sbjct: 60 LLKNKD 65

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target101 hypothetical protein CLIBASIA_05130 [Candidatus Liberib
25478020382 hypothetical protein CLIBASIA_00440 [Candidatus Liberib 1 3e-06
>gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Back     alignment and organism information
 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 12 EGNQYRPLRKEVRNAFPKILKSIEKALEPY-VDPLIEPVEIGKEGMVDEGYRLHICALIK 70
          +  +YRP ++EVR+AFP+++K++EK L  + V+PL  PV+   +G   E Y  H+C LI+
Sbjct: 2  DDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGY--ESYISHVCELIE 59

Query: 71 LLENRS 76
          LL+N+ 
Sbjct: 60 LLKNKD 65


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00