254781128

254781128

hypothetical protein CLIBASIA_05150

GeneID in NCBI database:8210153Locus tag:CLIBASIA_05150
Protein GI in NCBI database:254781128Protein Accession:YP_003065541.1
Gene range:-(1130992, 1131669)Protein Length:225aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MRDIRKIRNYFRNTAKIILSGLFLGFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccHHHcEEEEEEcHHHccccccEEEEEEEEccEEEEEccccccEEEEccccccEEEEccccccccccEEEEEEEEEEEEEccccHHHEEEEEEEEEccHHHHHEEEccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccEEEEEEEcccccHHHHHHcccccEEEEEEc
ccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcccccccccEEEEEccEEEcccEEEEEEcccccccccEEEccccccEEEEccccccEEEEEEEEEEEEEEcccccccccccccEEEEEEccEEEcccccHHHHHHEEEcccccEEEEEEEcccccccHHcHccEEEccHHHHEEEHcHHHHHcccccEEEEEEEEEEEcccccHHHHcccccccEEEEEEc
MRDIRKIRNYFRNTAKIILSGLflgffssaamadygyspqfqptimvsnfAKFKGLYVaadfskidhqspvrlqnlslngvsigldgqdgtlvygaslgvegfhleprggidgdkvaGTLLFRtgftfdnnnssilqntliygfggarirnimsvesaDTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRgeyryvacydqpwdvskwrekgdftaGVVLRF
mrdirkirNYFRNTAKIILSGLFLGFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGftfdnnnssilqNTLIYGFGGARIRNIMSVESADTAKSTirnivangfldkviGVGIEKKLASMLSIRGEYRYVACYDqpwdvskwrekGDFTAGVVLRF
MRDIRKIRNYFRNTAKIILSGLFLGFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF
*********YFRNTAKIILSGLFLGFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF
MRDIRKIRNYFRNTAKIILSGLFLGFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF
MRDIRKIRNYFRNTAKIILSGLFLGFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MRDIRKIRNYFRNTAKIILSGLFLGFFSSAAMADYGYSPQFQPTIMVSNFAKFKGLYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target225 hypothetical protein CLIBASIA_05150 [Candidatus Liberib
315122523229 hypothetical protein CKC_03875 [Candidatus Liberibacter 1 7e-29
225852776212 hypothetical protein BMEA_A1331 [Brucella melitensis AT 1 0.003
256113839212 hypothetical membrane protein [Brucella melitensis bv. 1 0.003
17987000185 22 kDa outer membrane protein precursor [Brucella melit 1 0.003
237815697222 Hypothetical protein, conserved [Brucella abortus str. 1 0.003
62290190212 hypothetical protein BruAb1_1285 [Brucella abortus bv. 1 0.004
>gi|315122523|ref|YP_004063012.1| hypothetical protein CKC_03875 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 229 Back     alignment and organism information
 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 93/235 (39%), Positives = 132/235 (56%), Gaps = 22/235 (9%)

Query: 2   RDIRKIRNYFRNTAKIILSGLFLGFFSSAAMADYGYSPQFQPTI-MVSNFAKFKGLYVAA 60
           +D RK    F   +K++ S LFLGFFSS+AMA       + P +   S+  K+KG Y++ 
Sbjct: 6   KDHRKSARIF---SKLLYSSLFLGFFSSSAMAANNSYEYYPPALNYQSSIPKWKGSYISV 62

Query: 61  DFSKI-----DHQSPVRLQNL--SLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDG 113
           D +       D    +R +++  +LN  + G D Q+GTLVYGAS+G E  H      ++ 
Sbjct: 63  DMANAALVGKDSVGIIRDRSVHAALNKFTFGFDSQEGTLVYGASIGYEN-HFTNGQIVNA 121

Query: 114 --DKVAGTLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNIMSVES-ADTAKSTIRNIVA 170
                A +L+ R+GFTFDN NSS+ QNT+IYG  G R+R++ S++S AD  K  +     
Sbjct: 122 AFQNSAISLMLRSGFTFDNANSSLFQNTVIYGAVGVRLRDVSSLKSVADVLKLDLTK--- 178

Query: 171 NGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF 225
              LD+V  VGIEKKLASMLS+  EYR V   +    +S  +  G    G+ LRF
Sbjct: 179 ---LDQVYAVGIEKKLASMLSMHAEYRIVDSINSAMTLSNAKT-GRIVYGLSLRF 229


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|225852776|ref|YP_002733009.1| hypothetical protein BMEA_A1331 [Brucella melitensis ATCC 23457] Length = 212 Back     alignment and organism information
>gi|256113839|ref|ZP_05454632.1| hypothetical membrane protein [Brucella melitensis bv. 3 str. Ether] Length = 212 Back     alignment and organism information
>gi|17987000|ref|NP_539634.1| 22 kDa outer membrane protein precursor [Brucella melitensis bv. 1 str. 16M] Length = 185 Back     alignment and organism information
>gi|237815697|ref|ZP_04594694.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] Length = 222 Back     alignment and organism information
>gi|62290190|ref|YP_221983.1| hypothetical protein BruAb1_1285 [Brucella abortus bv. 1 str. 9-941] Length = 212 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target225 hypothetical protein CLIBASIA_05150 [Candidatus Liberib
1orm_A148 Outer membrane protein X; OMPX, trosy, DHPC, detergents 0.003
>1orm_A Outer membrane protein X; OMPX, trosy, DHPC, detergents, lipids, micelles; NMR {Escherichia coli} SCOP: f.4.1.1 PDB: 1q9f_A 1q9g_A 1qj8_A* 1qj9_A Length = 148 Back     alignment and structure
 Score = 37.3 bits (86), Expect = 0.003
 Identities = 24/158 (15%), Positives = 40/158 (25%), Gaps = 20/158 (12%)

Query: 68  QSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVEGFHLEPRGGIDGDKVAGTLLFRTGFT 127
           QS  + Q   + G ++    ++     G                             G  
Sbjct: 11  QSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPA 70

Query: 128 FDNNNSSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLA 187
           +  N+        IYG  G       + E       T     +        G G++    
Sbjct: 71  YRIND-----WASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFS-------YGAGLQFNPM 118

Query: 188 SMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF 225
             +++   Y          DV      G + AGV  RF
Sbjct: 119 ENVALDFSYEQSRIRS--VDV------GTWIAGVGYRF 148


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00