254781129

254781129

hypothetical protein CLIBASIA_05155

GeneID in NCBI database:8210154Locus tag:CLIBASIA_05155
Protein GI in NCBI database:254781129Protein Accession:YP_003065542.1
Gene range:-(1132029, 1132340)Protein Length:103aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNIILSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE
ccHHHHHHHHHHccccEEEEEEEEcccHHHHcccHHHcccccHHHHHHccccHHHHHHHHEEEEEEcccHHHHHHHHcccEEEEEEcccEEEEEEcccHHccc
ccccHHHHHHHHHHHHHccccEEccccHHHccccHHHcccccccHHHHccccHHHHHHHHHHHHEEcccccHHHHHccccEEEccccccccEEEEcccccccc
MLRDGLHKAASNALNFATTQvqystftpekmKLSQdylgntnpdavnqlnlddqkINNIILSKamvfpnqsdiasLKEGVAlnlvkdeslSCVIAegekleke
MLRDGLHKAAsnalnfattqvQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNIILSKAMVFPNQSDIASLKEGVAlnlvkdeslscviaegekleke
MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNIILSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE
********AASNALNFATTQVQYSTFT**********LGNTNPDAVNQLNLDDQKINNIILSKAMVFP***D**SLKEGVALNLVKDESLSCVIA*GE*****
MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNIILSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE
*LRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNIILSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGE*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNIILSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target103 hypothetical protein CLIBASIA_05155 [Candidatus Liberib
315122524138 hypothetical protein CKC_03880 [Candidatus Liberibacter 1 4e-13
>gi|315122524|ref|YP_004063013.1| hypothetical protein CKC_03880 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 138 Back     alignment and organism information
 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (72%), Gaps = 4/80 (5%)

Query: 1   MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNII 60
           M R+ LH AASNAL FA  + + S+ T E ++ +QDYL +TNPDA+N LN+DDQK+ NI+
Sbjct: 52  MFRNSLHLAASNALKFAMAKFKSSSLTSEVLESAQDYLRSTNPDALNYLNIDDQKMTNIL 111

Query: 61  LSKAMVFPNQSDIA--SLKE 78
           +SK+  F +Q  ++  SLKE
Sbjct: 112 ISKS--FSSQDKLSDPSLKE 129


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00