254781133

254781133

hypothetical protein CLIBASIA_05175

GeneID in NCBI database:8210158Locus tag:CLIBASIA_05175
Protein GI in NCBI database:254781133Protein Accession:YP_003065546.1
Gene range:-(1135331, 1135810)Protein Length:159aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAENIYVITHEAWMHNKINRQSSVHKSL
cccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHcccccHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHccEEEEccccccccccccEEEEEEHHHHHHHHHHHHHHHHcc
cccEEEEEccccccHHHHHHHHHHHHHHHHccHccccccEEEEEEcccEEEEEEEEEcccccccEEEEEccccccHHHHHHHHHHHHcccHHccccHHEEEEcccccHHHHHHHHHcccccEEccHcccccccccEEEEEcHHHHHccccccccccccc
myntieitwggnakprINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIyhnycpisrvielsgasdckswLSRSVLKeiysypwnqlCCQAVIhripdedypqhrmltslggiryriprlrgrnaAENIYVITHEAWmhnkinrqssvhksl
myntieitwggnakpriNQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAENIYVITheawmhnkinrqssvhksl
MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAENIYVITHEAWMHNKINRQSSVHKSL
**NTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAENIYVITHEAWMHNK***********
MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAENIYVITHEAWMHNKIN*********
MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAENIYVITHEAWMHN************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAENIYVITHEAWMHNKINRQSSVHKSL
MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAENIYVITHEAWMHNKINRQSSVHKSL
MYNTIEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLRGRNAAENIYVITHEAWMHNKINRQSSVHKSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target159 hypothetical protein CLIBASIA_05175 [Candidatus Liberib
315122527147 hypothetical protein CKC_03895 [Candidatus Liberibacter 1 6e-60
227822436148 hypothetical protein NGR_c18910 [Sinorhizobium fredii N 1 2e-30
254720059156 hypothetical protein Bru83_11061 [Brucella sp. 83/13] L 1 3e-20
13470676131 hypothetical protein mll0450 [Mesorhizobium loti MAFF30 1 2e-13
167907340138 gp68 [Burkholderia pseudomallei NCTC 13177] Length = 13 2 7e-08
126443795150 gp68 [Burkholderia pseudomallei 668] Length = 150 2 9e-08
117925018147 hypothetical protein Mmc1_1721 [Magnetococcus sp. MC-1] 2 3e-07
120611049143 GP68 [Acidovorax citrulli AAC00-1] Length = 143 2 2e-06
218510550135 hypothetical protein RetlB5_25761 [Rhizobium etli Brasi 2 2e-06
312795767165 hypothetical protein RBRH_01708 [Burkholderia rhizoxini 2 4e-06
>gi|315122527|ref|YP_004063016.1| hypothetical protein CKC_03895 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 147 Back     alignment and organism information
 Score =  233 bits (594), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 107/147 (72%), Positives = 122/147 (82%)

Query: 5   IEITWGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISR 64
           +EI WGG   P INQ IADFVA+RI+  S GWDRFVS+G LK+N L+AG+IYHNYCP S 
Sbjct: 1   MEIIWGGTKTPAINQAIADFVAQRIQHGSRGWDRFVSIGFLKNNILMAGVIYHNYCPQSH 60

Query: 65  VIELSGASDCKSWLSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRI 124
           VIELSGASDCK WL+R  L+EIY YPWN+L CQAVIHR+PDEDYPQHRMLT LG IRYRI
Sbjct: 61  VIELSGASDCKRWLTRETLREIYGYPWNELKCQAVIHRVPDEDYPQHRMLTCLGAIRYRI 120

Query: 125 PRLRGRNAAENIYVITHEAWMHNKINR 151
           PRLRG + AENIYVIT+E W  N+IN+
Sbjct: 121 PRLRGEHEAENIYVITYENWAKNRINQ 147


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822436|ref|YP_002826408.1| hypothetical protein NGR_c18910 [Sinorhizobium fredii NGR234] Length = 148 Back     alignment and organism information
>gi|254720059|ref|ZP_05181870.1| hypothetical protein Bru83_11061 [Brucella sp. 83/13] Length = 156 Back     alignment and organism information
>gi|13470676|ref|NP_102245.1| hypothetical protein mll0450 [Mesorhizobium loti MAFF303099] Length = 131 Back     alignment and organism information
>gi|167907340|ref|ZP_02494545.1| gp68 [Burkholderia pseudomallei NCTC 13177] Length = 138 Back     alignment and organism information
>gi|126443795|ref|YP_001063337.1| gp68 [Burkholderia pseudomallei 668] Length = 150 Back     alignment and organism information
>gi|117925018|ref|YP_865635.1| hypothetical protein Mmc1_1721 [Magnetococcus sp. MC-1] Length = 147 Back     alignment and organism information
>gi|120611049|ref|YP_970727.1| GP68 [Acidovorax citrulli AAC00-1] Length = 143 Back     alignment and organism information
>gi|218510550|ref|ZP_03508428.1| hypothetical protein RetlB5_25761 [Rhizobium etli Brasil 5] Length = 135 Back     alignment and organism information
>gi|312795767|ref|YP_004028689.1| hypothetical protein RBRH_01708 [Burkholderia rhizoxinica HKI 454] Length = 165 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 159 hypothetical protein CLIBASIA_05175 [Candidatus Liberib
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; Provi 99.97
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; Prov 99.95
COG1670187 RimL Acetyltransferases, including N-acetylases of ribo 99.87
COG1247169 Sortase and related acyltransferases [Cell envelope bio 99.44
PRK09491144 rimI ribosomal-protein-alanine N-acetyltransferase; Pro 99.31
TIGR01575140 rimI ribosomal-protein-alanine acetyltransferase; Inter 99.03
PRK10975231 TDP-fucosamine acetyltransferase; Provisional 98.97
COG3981174 Predicted acetyltransferase [General function predictio 98.93
PRK03624140 putative acetyltransferase; Provisional 98.76
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransferase 98.57
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Provisio 98.52
KOG3139165 consensus 98.46
PTZ00330147 acetyltransferase; Provisional 98.34
pfam0844586 FR47 FR47-like protein. The members of this family are 98.19
COG0456177 RimI Acetyltransferases [General function prediction on 97.93
PRK10514146 hypothetical protein; Provisional 97.82
PRK10562145 hypothetical protein; Provisional 97.81
TIGR02382201 wecD_rffC TDP-D-fucosamine acetyltransferase; InterPro: 97.57
COG3393268 Predicted acetyltransferase [General function predictio 97.56
PRK07757152 acetyltransferase; Provisional 97.56
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 97.55
TIGR02406162 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferas 97.46
PRK09831147 hypothetical protein; Provisional 97.22
KOG3216163 consensus 97.21
KOG3396150 consensus 97.09
PRK10314153 hypothetical protein; Provisional 96.53
COG1246153 ArgA N-acetylglutamate synthase and related acetyltrans 96.22
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransferase 95.96
PRK05279441 N-acetylglutamate synthase; Validated 95.34
KOG3235193 consensus 91.72
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transferase 99.92
PRK10140162 putative acetyltransferase YhhY; Provisional 99.82
KOG4135185 consensus 98.67
cd0430183 GNAT GCN5-related N-acetyltransferases (GNAT) represent 98.97
pfam0058380 Acetyltransf_1 Acetyltransferase (GNAT) family. This fa 98.9
PRK07922170 N-acetylglutamate synthase; Validated 97.17
KOG2488202 consensus 96.4
PRK12308614 bifunctional argininosuccinate lyase/N-acetylglutamate 96.0
pfam0844489 Gly_acyl_tr_C Aralkyl acyl-CoA:amino acid N-acyltransfe 93.8
PRK01346 411 hypothetical protein; Provisional 90.22
COG3818167 Predicted acetyltransferase, GNAT superfamily [General 93.23
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase; InterPro: IPR006464 Histone acetylation is carried out by a class of enzymes known as histone acetyltransferases (HATs), which catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>KOG3139 consensus Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>pfam08445 FR47 FR47-like protein Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK10514 hypothetical protein; Provisional Back     alignment and domain information
>PRK10562 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase; InterPro: IPR012752 This entry represents the WecD protein (formerly RffC) for the biosynthesis of enterobacterial common antigen (ECA), an outer leaflet, outer membrane glycolipid with a trisaccharide repeat unit Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase; InterPro: IPR012772 This enzyme family is the EctA of ectoine biosynthesis Back     alignment and domain information
>PRK09831 hypothetical protein; Provisional Back     alignment and domain information
>KOG3216 consensus Back     alignment and domain information
>KOG3396 consensus Back     alignment and domain information
>PRK10314 hypothetical protein; Provisional Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>KOG3235 consensus Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>KOG4135 consensus Back     alignment and domain information
>cd04301 GNAT GCN5-related N-acetyltransferases (GNAT) represent a large superfamily of functionally diverse enzymes that catalyze the transfer of an acetyl group from acetyl-Coenzyme A to the primary amine of a wide range of acceptor substrates Back     alignment and domain information
>pfam00583 Acetyltransf_1 Acetyltransferase (GNAT) family Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>KOG2488 consensus Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>pfam08444 Gly_acyl_tr_C Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target159 hypothetical protein CLIBASIA_05175 [Candidatus Liberib
2zxv_A194 Crystal Structure Of Putative Acetyltransferase Fro 2e-14
2z0z_A194 Crystal Structure Of Putative Acetyltransferase Len 3e-14
2z10_A194 Crystal Structure Of Putative Acetyltransferase Len 4e-14
1yre_A197 Hypothetical Protein Pa3270 From Pseudomonas Aerugi 5e-13
1nsl_A184 Crystal Structure Of Probable Acetyltransferase Len 6e-13
3fbu_A168 The Crystal Structure Of The Acetyltransferase (Gna 7e-13
3pzj_A209 Crystal Structure Of A Probable Acetyltransferases 5e-10
2fck_A181 Structure Of A Putative Ribosomal-Protein-Serine Ac 4e-08
3igr_A184 The Crystal Structure Of Ribosomal-Protein-S5-Alani 1e-07
3r95_A188 Crystal Structure Of Microcin C7 Self Immunity Acet 1e-06
3owc_A188 Crystal Structure Of Gnat Superfamily Protein Pa257 2e-06
3eg7_A176 Spermidine N1-Acetyltransferase From Vibrio Cholera 2e-06
1s7f_A199 Riml- Ribosomal L7L12 ALPHA-N-Protein Acetyltransfe 4e-06
1z9u_A179 Structural Genomics, The Crystal Structure Of The A 5e-06
1s7k_A182 Riml- Ribosomal L7L12 ALPHA-N-Protein Acetyltransfe 5e-06
2vi7_A177 Structure Of A Putative Acetyltransferase (Pa1377)f 1e-04
2jlm_A182 Structure Of A Putative Acetyltransferase (Aciad163 2e-04
2ge3_A170 Crystal Structure Of Probable Acetyltransferase Fro 0.004
>gi|223673870|pdb|2ZXV|A Chain A, Crystal Structure Of Putative Acetyltransferase From T. Thermophilus Hb8 Length = 194 Back     alignment and structure
 Score = 82.0 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/150 (14%), Positives = 49/150 (32%), Gaps = 13/150 (8%)

Query: 17  INQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSGASDCKS 76
             + +   +   + +        V+  IL    +   I      P    +EL        
Sbjct: 46  TEEALRAHLEGLLGEPGR-----VNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPF 100

Query: 77  W---LSRSVLKEIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLR----- 128
           W    ++     +  + +  L  + V  ++   +    R L +LG +R  + R       
Sbjct: 101 WGSPANKEAKYLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPD 160

Query: 129 GRNAAENIYVITHEAWMHNKINRQSSVHKS 158
           G    + +Y +  E W   K   ++ ++ +
Sbjct: 161 GAFRDDVVYSVLKEEWPGVKARLEARLYGA 190


gi|160286355|pdb|2Z0Z|A Chain A, Crystal Structure Of Putative Acetyltransferase Length = 194 Back     alignment and structure
>gi|160286357|pdb|2Z10|A Chain A, Crystal Structure Of Putative Acetyltransferase Length = 194 Back     alignment and structure
>gi|61680801|pdb|1YRE|A Chain A, Hypothetical Protein Pa3270 From Pseudomonas Aeruginosa In Complex With Coa Length = 197 Back     alignment and structure
>gi|34810978|pdb|1NSL|A Chain A, Crystal Structure Of Probable Acetyltransferase Length = 184 Back     alignment and structure
gi|218766907|pdb|3FBU|A Chain A, The Crystal Structure Of The Acetyltransferase (Gnat Family) From Bacillus Anthracis Length = 168 Back     alignment and structure
>gi|319443820|pdb|3PZJ|A Chain A, Crystal Structure Of A Probable Acetyltransferases (Gnat Family) From Chromobacterium Violaceum Atcc 12472 Length = 209 Back     alignment and structure
>gi|90109322|pdb|2FCK|A Chain A, Structure Of A Putative Ribosomal-Protein-Serine Acetyltransferase From Vibrio Cholerae Length = 181 Back     alignment and structure
>gi|257097722|pdb|3IGR|A Chain A, The Crystal Structure Of Ribosomal-Protein-S5-Alanine Acetyltransferase From Vibrio Fischeri To 2.0a Length = 184 Back     alignment and structure
>gi|329666283|pdb|3R95|A Chain A, Crystal Structure Of Microcin C7 Self Immunity Acetyltransferase Mcce In Complex With Acetyl-Coa Length = 188 Back     alignment and structure
>gi|310942901|pdb|3OWC|A Chain A, Crystal Structure Of Gnat Superfamily Protein Pa2578 From Pseudomonas Aeruginosa Length = 188 Back     alignment and structure
>gi|208435743|pdb|3EG7|A Chain A, Spermidine N1-Acetyltransferase From Vibrio Cholerae Length = 176 Back     alignment and structure
>gi|62737938|pdb|1S7F|A Chain A, Riml- Ribosomal L7L12 ALPHA-N-Protein Acetyltransferase Crystal Form I (Apo) Length = 199 Back     alignment and structure
gi|71042227|pdb|1Z9U|A Chain A, Structural Genomics, The Crystal Structure Of The Acetyl Transferase, Modifies N-Terminal Serine Of 50s Ribosomal Subunit Protein L7L12 FROM SALMONELLA TYPHIMURIUM Length = 179 Back     alignment and structure
>gi|62737939|pdb|1S7K|A Chain A, Riml- Ribosomal L7L12 ALPHA-N-Protein Acetyltransferase Crystal Form 2 (Apo) Length = 182 Back     alignment and structure
gi|188595865|pdb|2VI7|A Chain A, Structure Of A Putative Acetyltransferase (Pa1377)from Pseudomonas Aeruginosa Length = 177 Back     alignment and structure
gi|221046449|pdb|2JLM|A Chain A, Structure Of A Putative Acetyltransferase (Aciad1637) From Acinetobacter Baylyi Adp1 Length = 182 Back     alignment and structure
>gi|99032468|pdb|2GE3|A Chain A, Crystal Structure Of Probable Acetyltransferase From Agrobacterium Tumefaciens Length = 170 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target159 hypothetical protein CLIBASIA_05175 [Candidatus Liberib
1yre_A197 Hypothetical protein PA3270; APC5563, midwest center fo 99.95
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha/beta 99.95
3eg7_A176 Spermidine N1-acetyltransferase; structural genomics, I 99.93
2fck_A181 Ribosomal-protein-serine acetyltransferase, putative; s 99.92
1nsl_A184 Probable acetyltransferase; structural genomics, hexame 99.92
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; HET: C 99.92
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; PSI, 99.91
1s7k_A182 Acetyl transferase; GNAT, coenzyme A; 1.80A {Salmonella 99.89
3owc_A188 Probable acetyltransferase; structural genomics, PSI-2, 99.88
3fbu_A168 Acetyltransferase, GNAT family; structural genomics, PS 99.88
2fsr_A195 Acetyltranferase; alpha-beta-sandwich, structural genom 99.82
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltr 99.79
3juw_A175 Probable GNAT-family acetyltransferase; structural geno 99.78
2jlm_A182 Putative phosphinothricin N-acetyltransferase; methioni 99.74
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A, str 99.7
2qml_A198 BH2621 protein; NP_243487.1, uncharacterized protein BH 99.7
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroqu 99.69
2ge3_A170 Probable acetyltransferase; structural genomics, PSI, p 99.69
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 famil 99.64
1vhs_A175 Similar to phosphinothricin acetyltransferase; structur 99.61
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransferase, G 99.6
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; struct 99.6
3dr6_A174 YNCA; acetyltransferase, csgid target, essential gene, 99.54
3kkw_A182 Putative uncharacterized protein; acetyltransferase, GN 99.46
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, acetyltr 99.46
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1 99.4
2i6c_A160 Putative acetyltransferase; GNAT family, structural gen 99.3
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobu 99.13
1tiq_A180 Protease synthase and sporulation negative regulatory p 98.96
1u6m_A199 Acetyltransferase, GNAT family; structural genomics, PS 98.76
1y9w_A140 Acetyltransferase; structural genomics, protein structu 98.67
2fiw_A172 GCN5-related N- acetyltransferase:aminotransferase, cla 98.52
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransferase, 99.92
3dns_A135 Ribosomal-protein-alanine acetyltransferase; MCSG, PSI, 99.88
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, legion 99.58
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-acetyltr 99.36
2fl4_A149 Spermine/spermidine acetyltransferase; structural genom 99.31
2cnt_A160 Modification of 30S ribosomal subunit protein S18; N-al 99.26
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransferase, 99.21
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; puta 99.19
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha-beta 99.13
3dsb_A157 Putative acetyltransferase; APC60368.2, structural geno 99.09
2cy2_A174 TTHA1209, probable acetyltransferase; structural genomi 99.08
1on0_A158 YYCN protein; structural genomics, alpha-beta protein w 99.07
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural genom 99.06
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coenzyme 99.01
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyltrans 99.0
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltransfe 99.0
2fia_A162 Acetyltransferase; structural genomics, PSI, protein st 98.96
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A putat 98.96
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, structural 98.96
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwich, s 98.95
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltransfera 98.92
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, stru 98.91
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, structural 98.88
3lod_A162 Putative acyl-COA N-acyltransferase; structural genomic 98.88
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, COA, ribos 98.86
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, RIMI 98.86
1sqh_A312 Hypothetical protein CG14615-PA; structural genomics, P 98.85
2g3a_A152 Acetyltransferase; ACETYLFTRANSFERASE, structural genom 98.82
1y9k_A157 IAA acetyltransferase; structural genomics, midwest cen 98.8
1vkc_A158 Putative acetyl transferase; structural genomics, south 98.78
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, structur 98.78
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral genomics 98.76
1wwz_A159 Hypothetical protein PH1933; structural genomics, riken 98.73
2aj6_A159 Hypothetical protein MW0638; acetyltransferase (GNAT) f 98.7
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, acetyl 98.69
3fix_A183 N-acetyltransferase; termoplasma acidophilum, structura 98.68
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomics, PS 98.68
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase; acy 98.68
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, stru 98.66
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic bios 98.59
2b5g_A171 Diamine acetyltransferase 1; structural genomics, PSI, 98.59
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, structural 98.53
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, anti 98.51
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, putative 98.51
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/ 98.51
3h4q_A188 Putative acetyltransferase; NP_371943.1, structural gen 98.48
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzyme-inh 98.48
3ey5_A181 Acetyltransferase-like, GNAT family; structural genomic 98.47
2gan_A190 182AA long hypothetical protein; alpha-beta protein., s 98.47
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, acetyltr 98.33
3frm_A254 Uncharacterized conserved protein; APC61048, structural 98.32
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, structural 98.31
1z4r_A168 General control of amino acid synthesis protein 5-like 98.3
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 1.80 98.18
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {B 98.16
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structural gen 98.14
1ygh_A164 ADA4, protein (transcriptional activator GCN5); transcr 98.07
3efa_A147 Putative acetyltransferase; structural genomics, PSI-2, 98.03
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate synthas 97.99
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-acetyl 97.94
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, acyl 97.92
1xeb_A150 Hypothetical protein PA0115; midwest center for structu 97.87
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu tern 97.86
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic bios 97.59
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP protein, 96.78
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltransfera 95.9
2i00_A 406 Acetyltransferase, GNAT family; structural genomics, PS 95.54
2hv2_A 400 Hypothetical protein; PSI, protein structure initiative 94.33
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, protein-pr 94.11
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, acetyltr 92.26
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062,meth 99.49
3exn_A160 Probable acetyltransferase; GCN5-related N-acetyltransf 99.32
2eui_A153 Probable acetyltransferase; dimer, structural genomics, 98.8
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE, ace 98.79
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; structural 98.76
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron cass 98.67
3i3g_A161 N-acetyltransferase; malaria, structural genomics, stru 98.51
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, polyket 98.3
3mgd_A157 Predicted acetyltransferase; structural genomics, PSI-2 98.27
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, structural 96.53
3iwg_A276 Acetyltransferase, GNAT family; structural genomics, AP 99.06
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, GNAT f 98.86
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- acetyl 98.84
2fe7_A166 Probable N-acetyltransferase; structural genomics, PSI, 98.74
3ec4_A228 Putative acetyltransferase from the GNAT family; YP_497 98.61
3jvn_A166 Acetyltransferase; alpha-beta protein, structural genom 98.49
1y7r_A133 Hypothetical protein SA2161; structural genomics, prote 98.35
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase, COA 98.19
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, 98.12
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, putat 98.02
2ozh_A142 Hypothetical protein XCC2953; NP_638301.1, structural g 97.77
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural genomi 97.71
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GCN5-re 97.7
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding moti 96.28
2qec_A204 Histone acetyltransferase HPA2 and related acetyltransf 96.14
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSCG, protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
Probab=99.95  E-value=4.1e-27  Score=174.54  Aligned_cols=143  Identities=17%  Similarity=0.172  Sum_probs=121.3

Q ss_pred             ECCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCEEEEEEEEEEEECCCCCCCEEE-ECC---CCCCHHHHHHH
Q ss_conf             36898799989999999997200114878549999825760767999999834678311368-637---76603599999
Q gi|254781133|r    9 WGGNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSG-ASD---CKSWLSRSVLK   84 (159)
Q Consensus         9 W~~~~~P~t~e~~~~wi~~~~~~~~~~~~~~~ai~i~~~g~lvG~v~l~~~~~~~~~~eig~-~~~---~~~~~~~ea~~   84 (159)
                      |.....|...+....++....    .  +..+.+.++.++++||.++++++++.++.+|||+ ++.   +++|++++++.
T Consensus        46 ~~~~~~~~~~~~~~~~~~~~~----~--~~~~~~~i~~~~~~iG~~~l~~~~~~~~~~eiG~~~l~~~~~g~G~~~ea~~  119 (197)
T 1yre_A           46 LQYMDGPTRPDWYRQSLAEQR----E--GRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKY  119 (197)
T ss_dssp             TTTSSSTTSHHHHHHHHHHHH----T--TSEEEEEEEETTEEEEEEEEEEEETTTTEEEEEEEEECGGGTTTTHHHHHHH
T ss_pred             HCCCCCCCCHHHHHHHHHHHH----C--CCEEEEEEEECCEEEEEEEEEEECCCCCEEEEEEEEEEHHHCCCCEEHHHHH
T ss_conf             325899999999999999986----6--9817999998998999999886147899899999997501079757015688


Q ss_pred             HHHHHHHCCCCEEEEEEEEECCCCHHHHHHHHCCCEEEEEECCC-----CCEEEEEEEEECHHHHHHHHHHHHHHHHH
Q ss_conf             99998624865079999982642158999987495896676128-----94100799986288986101234566752
Q gi|254781133|r   85 EIYSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRLR-----GRNAAENIYVITHEAWMHNKINRQSSVHK  157 (159)
Q Consensus        85 ~l~~~aF~~l~l~Ri~~~~~~~N~~S~rv~eklGF~~egv~R~~-----G~~~d~~v~~l~~~eW~~~~~~~~~~~~~  157 (159)
                      ++++|+|++++++||++.|.++|.+|+++++|+||++||+.|.+     |+++|.++|+||++||++.|....+++++
T Consensus       120 ~li~~aF~~l~l~ri~~~v~~~N~~S~~~~ek~GF~~eg~~r~~~~~~~G~~~D~~~y~i~~~ew~~~k~~l~~~~~~  197 (197)
T 1yre_A          120 LMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASFTG  197 (197)
T ss_dssp             HHHHHHHHTSCCSEEEEEEETTCHHHHHHHHHHTCEEEEEEEEEEECTTSCEEEEEEEEEETTTHHHHHHHHHHTC--
T ss_pred             HHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCCCEEEEEECCCEECCCCEEEEEEEEEEEHHHHHHHHHHHHHHCCC
T ss_conf             999999861587369986355799999999987999999962556948990999999997699999999999855259



>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP01616, center for structural genomics of infectious diseases, csgid; HET: MSE; 2.38A {Vibrio cholerae} Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putative; structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor str} SCOP: d.108.1.1 Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein structure initiative; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 2.00A {Vibrio fischeri ES114} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT, coenzyme A; 1.80A {Salmonella typhimurium LT2} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2fsr_A Acetyltranferase; alpha-beta-sandwich, structural genomics, PSI, protein structure initiative; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, PSI-2, protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structural genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>2qml_A BH2621 protein; NP_243487.1, uncharacterized protein BH2621, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics; HET: MSE; 1.75A {Salmonella typhimurium} PDB: 3dr8_A* Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, structural genomics, PSI-2, protein structure initiative; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, protein structure initiative, PSI, midwest center for structural genomics, MCSG; 1.90A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>2fiw_A GCN5-related N- acetyltransferase:aminotransferase, class-II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase; HET: ACO; 2.35A {Rhodopseudomonas palustris CGA009} SCOP: d.108.1.1 Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; MCSG, PSI, structural genomics, protein structure initiative; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structural genomics, PSI; HET: GOL; 2.19A {Enterococcus faecalis V583} SCOP: d.108.1.1 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 1.60A {Enterococcus faecalis V583} SCOP: d.108.1.1 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal protein, acetyltransferase; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.48A {Clostridium difficile 630} Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus HB8} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel beta strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics; HET: ACO; 1.66A {Escherichia coli CFT073} PDB: 2fs5_A* Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis V583} SCOP: d.108.1.1 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase (GNAT) family; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE MRD GOL; 1.31A {Bacillus cereus atcc 10987} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD; HET: COA ACO; 1.60A {Mycobacterium tuberculosis H37RV} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.00A {Shigella flexneri 2a str} Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, protein structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, COA, ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural genomics, PSI-2, protein structure initiative; 1.75A {Listeria innocua CLIP11262} Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>2g3a_A Acetyltransferase; ACETYLFTRANSFERASE, structural genomics, PSI, protein structure initiative; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics (MCSG), PSI, protein structure initiative; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural genomics, joint center for structural genomics, JCSG; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: ACO; 1.75A {Pyrococcus horikoshii OT3} SCOP: d.108.1.1 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; acetyltransferase (GNAT) family, NP_645455.1, structural genomics, PSI, protein structure initiative; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural genomics; HET: MSE; 1.80A {Streptococcus suis 89} Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural genomics, PSI-2, protein structure initiative; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB24, acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, PSI-2, protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein structure initiative; 2.10A {Pyrococcus horikoshii OT3} SCOP: d.108.1.1 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation, N- acetyltransferase; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli K12} Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural genomics, protein structure initiative, PSI; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD; HET: COA ACO; 1.60A {Mycobacterium tuberculosis H37RV} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.30A {Enterococcus faecalis V583} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for structural genomics, MCSG, structural genomics; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product complex, antibiotic synthase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransferase (GNAT) family, structural genomics, joint center for structural genomics; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, structural genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, PSI, structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus HB8} Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketide synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula 19L} PDB: 2ref_A* Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiative; HET: MSE; 2.30A {Colwellia psychrerythraea 34H} Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, protein structure initiative; 2.00A {Bacillus halodurans c-125} SCOP: d.108.1.1 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglycoside resistance; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, structural genomics, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.61A {Vibrio fischeri ES114} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics, MCSG; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase, structural genomics; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; NP_638301.1, structural genomics, joint center for structural genomics, JCSG; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure initiative; 2.01A {Streptococcus pneumoniae TIGR4} SCOP: d.108.1.1 Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis H37RV} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target159 hypothetical protein CLIBASIA_05175 [Candidatus Liberib
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginosa [Ta 99.94
d2fcka1178 Putative ribosomal-protein-serine acetyltransferase VC1 99.92
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis [Tax 99.91
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase RimL 99.89
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium tumefa 99.71
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium tumef 99.68
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginosa [Ta 99.68
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH {Bacil 99.61
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium tumef 99.57
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium tube 99.52
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aerugino 99.41
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae [TaxI 99.36
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus thermophil 99.27
d1tiqa_173 Protease synthase and sporulation negative regulatory p 99.03
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus [Tax 98.86
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus faecali 98.66
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudomonas 98.43
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus faecali 99.36
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1086 { 99.22
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis [Tax 99.07
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxId: 14 98.95
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus faecali 98.91
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Saccharo 98.86
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosis [Ta 98.85
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus subtilis 98.81
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furiosus 98.79
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium tumef 98.75
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} 98.71
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonel 98.71
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas aerugi 98.65
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxI 98.65
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcus fae 98.6
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxId: 14 98.51
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's 98.47
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii [Tax 98.47
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii [Tax 98.36
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxI 98.34
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus [Tax 98.32
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia marcesce 98.2
d2jdca1145 Probable acetyltransferase YitI {Bacillus licheniformis 98.19
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase {Hum 98.16
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase {Bak 98.09
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase {Tet 98.03
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis [Tax 97.82
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginosa [Ta 97.73
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus pneumo 97.53
d2hv2a2 285 Hypothetical protein EF1021 {Enterococcus faecalis [Tax 95.89
d2i00a2 291 Putative acetyltransferase EF2353 {Enterococcus faecali 95.84
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tu 95.68
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena variabilis 95.42
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodurans [ 98.85
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aerugino 98.83
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosophila 98.83
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId 98.32
d1p0ha_ 308 Mycothiol synthase MshD {Mycobacterium tuberculosis [Ta 95.52
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus [Tax 93.6
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Hypothetical protein PA3270
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.94  E-value=4.7e-26  Score=167.06  Aligned_cols=138  Identities=18%  Similarity=0.187  Sum_probs=115.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCEEEEEEEEEEEECCCCCCCEEE-ECC---CCCCHHHHHHHHH
Q ss_conf             898799989999999997200114878549999825760767999999834678311368-637---7660359999999
Q gi|254781133|r   11 GNAKPRINQIIADFVAKRIKDCSSGWDRFVSMGILKSNFLVAGIIYHNYCPISRVIELSG-ASD---CKSWLSRSVLKEI   86 (159)
Q Consensus        11 ~~~~P~t~e~~~~wi~~~~~~~~~~~~~~~ai~i~~~g~lvG~v~l~~~~~~~~~~eig~-~~~---~~~~~~~ea~~~l   86 (159)
                      ..+.|.+.+.....+...    ..  +..+++.++.+|++||.+++.++++.++.+|||+ ++.   +++|++++++.++
T Consensus        36 ~~~~~~~~~~~~~~~~~~----~~--~~~~~~~i~~~g~~iG~i~l~~~~~~~~~~eiG~~~l~~~~~g~G~~~ea~~~l  109 (183)
T d1yrea1          36 YMDGPTRPDWYRQSLAEQ----RE--GRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLM  109 (183)
T ss_dssp             TSSSTTSHHHHHHHHHHH----HT--TSEEEEEEEETTEEEEEEEEEEEETTTTEEEEEEEEECGGGTTTTHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHH----HC--CCCEEEEEEECCEEEEEEEEEECCCCCCEEEEEEEEECHHHCCCCCCHHHHHHH
T ss_conf             689999999999999997----57--981599999999999999966213669869999999558772976114578887


Q ss_pred             HHHHHCCCCEEEEEEEEECCCCHHHHHHHHCCCEEEEEECC-----CCCEEEEEEEEECHHHHHHHHHHHHHH
Q ss_conf             99862486507999998264215899998749589667612-----894100799986288986101234566
Q gi|254781133|r   87 YSYPWNQLCCQAVIHRIPDEDYPQHRMLTSLGGIRYRIPRL-----RGRNAAENIYVITHEAWMHNKINRQSS  154 (159)
Q Consensus        87 ~~~aF~~l~l~Ri~~~~~~~N~~S~rv~eklGF~~egv~R~-----~G~~~d~~v~~l~~~eW~~~~~~~~~~  154 (159)
                      ++|+|++++++||.+.|.++|.+|+++++|+||++||+.|.     .|+++|.++|+||++||.+.|-..+++
T Consensus       110 ~~~af~~lg~~~i~~~v~~~N~aS~~~~~k~Gf~~eg~~r~~~~~~~G~~~D~~~y~l~~~dw~~~k~~~~a~  182 (183)
T d1yrea1         110 LKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEAS  182 (183)
T ss_dssp             HHHHHHTSCCSEEEEEEETTCHHHHHHHHHHTCEEEEEEEEEEECTTSCEEEEEEEEEETTTHHHHHHHHHHT
T ss_pred             HHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEEEECCEECCCCCEEEEEEEEEEHHHHHHHHHHHHHC
T ss_conf             5332421586317754254788888567506747999962346958992999999996899999999988635



>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure