254781134

254781134

hypothetical protein CLIBASIA_05180

GeneID in NCBI database:8210159Locus tag:CLIBASIA_05180
Protein GI in NCBI database:254781134Protein Accession:YP_003065547.1
Gene range:-(1135813, 1136775)Protein Length:320aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:conserved hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MQAGGSLPAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMILWEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFWQGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHSYPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVIVSSGKSINDIQINNAKLLVE
cccccccccccEEEccccccHHHHHHHHHccccEEEEEcccccccccEEEEEEEEcccccccEEEEEEccEEEEEEEcccEEHHHHHHccccccccccHHHHHHHHHHHHcccccEEEEEEccccEEEEEcccccccccEEEEEEEEccccEEcccccccEEEEEEcccEEEEccccEEEEEEEccccccccHHHcccccEEEccccccHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccccccccHHHcccccccccEEEEEcccHHHHccccccccEEEEEEEEEEccccccccEEEcccEEEc
cccccEEEEcEEEccccccccccEEEEEEcccEEEEEEcccccccccccEEEEEEcccccccEEEEEccccEEEEEccccEEHHHEEEcccHHHHHHHHHHHHHHHHEEEccccccEEEEcccccEEEEEccccccccccEEEEEEccccccEccccccEEEEEEEcccEEEEccccEEEEEEccccccccccccccccHHHcccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccccccccEHEHHHHHHHHHHEEEEcccEEEEEEEEEccccHcHcHHHcHHHHcc
mqaggslpagfswstesgdgLSTLCVFLSTLGEVavyggdnpddsssfsLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQEektnlplswpiQEQWEQAIMVAPTGWSMILWEKRNMLLiscpknsllsdKTFVMNVAhnnrwssfhNWFTQSYVVAnenlffgdyegtfwqgdisgsdnarpfigiylspfhaidprlgFQRRACVAHLSLQAYQRPYLKLFAranydhsypefsketisnnpmdngiwdnslwdevkwtdnLFVTKKKLFQFCQNVVAYGNCLAVGCVIvssgksindiqinnaKLLVE
mqaggslpagfswstesGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMILWEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFWQGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHSYPEFsketisnnpMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVIvssgksindiqinnakllve
MQAGGSLPAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMILWEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFWQGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHSYPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVIVSSGKSINDIQINNAKLLVE
***GGSLPAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQ*EKT**PLSWPIQEQWEQAIMVAPTGWSMILWEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFWQGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHSYPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVIVSSGKSINDIQINNAKLLV*
********AGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMILWEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFWQGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHSYPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVIVSSGKSINDIQINNAKLLVE
***GGSLPAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMILWEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFWQGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHSYPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVIVSSGKSINDIQINNAKLLVE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAGGSLPAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMILWEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFWQGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHSYPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVIVSSGKSINDIQINNAKLLVE
MQAGGSLPAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMILWEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFWQGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHSYPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVIVSSGKSINDIQINNAKLLVE
MQAGGSLPAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMILWEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFWQGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHSYPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVIVSSGKSINDIQINNAKLLVE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target320 hypothetical protein CLIBASIA_05180 [Candidatus Liberib
315122528532 hypothetical protein CKC_03900 [Candidatus Liberibacter 1 1e-146
227822437536 hypothetical protein NGR_c18920 [Sinorhizobium fredii N 1 4e-68
150397022538 hypothetical protein Smed_1819 [Sinorhizobium medicae W 1 5e-66
316933870558 hypothetical protein Rpdx1_2528 [Rhodopseudomonas palus 1 3e-32
306839390481 Hypothetical protein BROD_2246 [Brucella sp. NF 2653] L 1 1e-27
254720058481 hypothetical protein Bru83_11056 [Brucella sp. 83/13] L 1 1e-27
110632595632 hypothetical protein Meso_0234 [Mesorhizobium sp. BNC1] 1 2e-25
13470677528 hypothetical protein mll0452 [Mesorhizobium loti MAFF30 1 4e-22
319783505617 hypothetical protein Mesci_3814 [Mesorhizobium ciceri b 1 5e-20
117925017508 hypothetical protein Mmc1_1720 [Magnetococcus sp. MC-1] 1 5e-19
>gi|315122528|ref|YP_004063017.1| hypothetical protein CKC_03900 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 532 Back     alignment and organism information
 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 249/320 (77%), Positives = 280/320 (87%)

Query: 1   MQAGGSLPAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPL 60
           MQAGGSL AGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPD   SF+LKAIYHIGRPL
Sbjct: 213 MQAGGSLFAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDSIDSFALKAIYHIGRPL 272

Query: 61  GKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMIL 120
           GK+AI+FVKNDVWIAT NGLISMKNILLQ E  NLPLS  IQE+W QAIM  PTGWS+ L
Sbjct: 273 GKKAIIFVKNDVWIATTNGLISMKNILLQGEGANLPLSSAIQEEWNQAIMEVPTGWSLTL 332

Query: 121 WEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFW 180
           WEKRNMLL+SCP++SLLS KT VMNV +NN W+S HNWFTQSYV+AN+NLFFGDYEG+FW
Sbjct: 333 WEKRNMLLVSCPQHSLLSSKTLVMNVDNNNYWASLHNWFTQSYVIANDNLFFGDYEGSFW 392

Query: 181 QGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHS 240
           QGDISGSD+ RPF  IYLSPF      LG +R+AC AH+SLQAYQRPYLKLF+R++YD S
Sbjct: 393 QGDISGSDDNRPFQAIYLSPFRESYSYLGVKRKACQAHISLQAYQRPYLKLFSRSDYDKS 452

Query: 241 YPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVI 300
           YP+F KET++ NP+++G+WDNS+WDE +WTDN F+ KKKLF F QNVVAYGN LAVGCVI
Sbjct: 453 YPDFFKETVNANPINSGLWDNSIWDESQWTDNFFIRKKKLFNFSQNVVAYGNFLAVGCVI 512

Query: 301 VSSGKSINDIQINNAKLLVE 320
           VSSGK INDIQINN+KLLVE
Sbjct: 513 VSSGKFINDIQINNSKLLVE 532


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822437|ref|YP_002826409.1| hypothetical protein NGR_c18920 [Sinorhizobium fredii NGR234] Length = 536 Back     alignment and organism information
>gi|150397022|ref|YP_001327489.1| hypothetical protein Smed_1819 [Sinorhizobium medicae WSM419] Length = 538 Back     alignment and organism information
>gi|316933870|ref|YP_004108852.1| hypothetical protein Rpdx1_2528 [Rhodopseudomonas palustris DX-1] Length = 558 Back     alignment and organism information
>gi|306839390|ref|ZP_07472204.1| Hypothetical protein BROD_2246 [Brucella sp. NF 2653] Length = 481 Back     alignment and organism information
>gi|254720058|ref|ZP_05181869.1| hypothetical protein Bru83_11056 [Brucella sp. 83/13] Length = 481 Back     alignment and organism information
>gi|110632595|ref|YP_672803.1| hypothetical protein Meso_0234 [Mesorhizobium sp. BNC1] Length = 632 Back     alignment and organism information
>gi|13470677|ref|NP_102246.1| hypothetical protein mll0452 [Mesorhizobium loti MAFF303099] Length = 528 Back     alignment and organism information
>gi|319783505|ref|YP_004142981.1| hypothetical protein Mesci_3814 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 617 Back     alignment and organism information
>gi|117925017|ref|YP_865634.1| hypothetical protein Mmc1_1720 [Magnetococcus sp. MC-1] Length = 508 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target320 hypothetical protein CLIBASIA_05180 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 4e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 40.8 bits (94), Expect = 4e-04
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 14/41 (34%)

Query: 211 QRRACVAHLS-LQAYQRPYLKLFARANYDHSYPEFS-KETI 249
           +++A    L  LQA     LKL+A    D S P  + K T+
Sbjct: 18  EKQA----LKKLQAS----LKLYA----DDSAPALAIKATM 46


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00