254781139

254781139

hypothetical protein CLIBASIA_05205

GeneID in NCBI database:8210164Locus tag:CLIBASIA_05205
Protein GI in NCBI database:254781139Protein Accession:YP_003065552.1
Gene range:-(1138539, 1138736)Protein Length:65aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60-----
MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRTSEGYV
ccHHHHHHHHHHHccccHHHHHHccHHHHcccHHHHHHccccccHHHHHHccccccccccccccc
cHHHHHHHHHHHHHcccHHHHHcccHHHHHccHHHHcccccccEEEEHHcccccccccEcccccc
MEINQACAMATRkknrdwqriasipvsilkdshllqahtegddvwvnkwlnnrdnaswrtsegyv
MEINQACAMatrkknrdwqrIASIPVSILKDSHLLQAHTegddvwvnkwlnnrdnaswrtsegyv
MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRTSEGYV
***************RDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASW*******
****************DWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNAS********
*EINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDN**WR******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRTSEGYV
MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRTSEGYV
MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRTSEGYV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target65 hypothetical protein CLIBASIA_05205 [Candidatus Liberib
315122532118 hypothetical protein CKC_03920 [Candidatus Liberibacter 1 2e-21
150397026107 hypothetical protein Smed_1823 [Sinorhizobium medicae W 1 9e-09
227822440107 hypothetical protein NGR_c18950 [Sinorhizobium fredii N 1 9e-07
>gi|315122532|ref|YP_004063021.1| hypothetical protein CKC_03920 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 118 Back     alignment and organism information
 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/65 (70%), Positives = 59/65 (90%)

Query: 1   MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRT 60
           +++NQACA+++ KK  DWQRIAS+P+S+++ SHLLQAH+EGDD WV+KWLNNRDNASWRT
Sbjct: 54  LDLNQACAVSSGKKREDWQRIASVPLSVVRSSHLLQAHSEGDDQWVSKWLNNRDNASWRT 113

Query: 61  SEGYV 65
           SEG V
Sbjct: 114 SEGCV 118


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397026|ref|YP_001327493.1| hypothetical protein Smed_1823 [Sinorhizobium medicae WSM419] Length = 107 Back     alignment and organism information
>gi|227822440|ref|YP_002826412.1| hypothetical protein NGR_c18950 [Sinorhizobium fredii NGR234] Length = 107 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00