254781138

254781138

hypothetical protein CLIBASIA_05200

GeneID in NCBI database:8210163Locus tag:CLIBASIA_05200
Protein GI in NCBI database:254781138Protein Accession:YP_003065551.1
Gene range:-(1138002, 1138538)Protein Length:178aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPLPDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPPLTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRSW
cccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccHHHHHHHHHHHcccccHHHHHHHHccccccEEEEEccEEEEEEccccEEEEEEEEccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccc
ccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccccccccEEEEEccEEEEEccccccEEEEEEEcccccccccccHHHHHccccHEHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccc
MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVegsaplpddyiEIRFlednkgnkldhlplsislqknkgyiitadsicvlpissedVVLYYYacippltennpvnwllhrapdlylYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRSW
MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSlvegsaplpdDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPPLTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESikklqqndirsw
MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPLPDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPPLTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRSW
**KDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPLPDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPPLTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIK*LQQN*****
MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPLPDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPPLTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIK**********
*AKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPLPDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPPLTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPLPDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPPLTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRSW
MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPLPDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPPLTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRSW
MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPLPDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPPLTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRSW

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target178 hypothetical protein CLIBASIA_05200 [Candidatus Liberib
315122531191 hypothetical protein CKC_03915 [Candidatus Liberibacter 1 8e-84
227822439198 hypothetical protein NGR_c18940 [Sinorhizobium fredii N 1 9e-33
150397025200 hypothetical protein Smed_1822 [Sinorhizobium medicae W 1 4e-28
170752055217 hypothetical protein Mrad2831_5687 [Methylobacterium ra 1 1e-12
148257049217 hypothetical protein BBta_5781 [Bradyrhizobium sp. BTAi 1 5e-08
307308930191 hypothetical protein SinmeBDRAFT_4497 [Sinorhizobium me 1 6e-07
160897393205 constituent protein [Delftia acidovorans SPH-1] Length 1 6e-07
27476047208 constituent protein [Pseudomonas phage PaP3] Length = 2 1 7e-06
167600433208 phage particle protein [Pseudomonas phage LUZ24] Length 1 1e-05
241760941219 constituent protein [Zymomonas mobilis subsp. mobilis A 1 5e-05
>gi|315122531|ref|YP_004063020.1| hypothetical protein CKC_03915 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 191 Back     alignment and organism information
 Score =  313 bits (801), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (92%)

Query: 1   MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPL 60
           MAKD+ASLLIDVSHY EK GFT LFK+FLHRIEVKINR LRLREME+K  LSLVEGS  L
Sbjct: 1   MAKDYASLLIDVSHYTEKSGFTCLFKDFLHRIEVKINRELRLREMEKKAFLSLVEGSVIL 60

Query: 61  PDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPP 120
           PDD+IE+RFL D++GNKLDHLPLSISLQKNKGYIITADSICV P SSEDVVLYYYACIPP
Sbjct: 61  PDDFIEMRFLTDHQGNKLDHLPLSISLQKNKGYIITADSICVSPPSSEDVVLYYYACIPP 120

Query: 121 LTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRS 177
           LT+NNP+NWLL R+PDLYLYGL+EE+ALWEQKIDKA+TA ALFQESIK+LQ+NDIRS
Sbjct: 121 LTDNNPINWLLQRSPDLYLYGLIEEVALWEQKIDKASTAGALFQESIKRLQKNDIRS 177


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822439|ref|YP_002826411.1| hypothetical protein NGR_c18940 [Sinorhizobium fredii NGR234] Length = 198 Back     alignment and organism information
>gi|150397025|ref|YP_001327492.1| hypothetical protein Smed_1822 [Sinorhizobium medicae WSM419] Length = 200 Back     alignment and organism information
>gi|170752055|ref|YP_001758315.1| hypothetical protein Mrad2831_5687 [Methylobacterium radiotolerans JCM 2831] Length = 217 Back     alignment and organism information
>gi|148257049|ref|YP_001241634.1| hypothetical protein BBta_5781 [Bradyrhizobium sp. BTAi1] Length = 217 Back     alignment and organism information
>gi|307308930|ref|ZP_07588613.1| hypothetical protein SinmeBDRAFT_4497 [Sinorhizobium meliloti BL225C] Length = 191 Back     alignment and organism information
>gi|160897393|ref|YP_001562975.1| constituent protein [Delftia acidovorans SPH-1] Length = 205 Back     alignment and organism information
>gi|27476047|ref|NP_775249.1| constituent protein [Pseudomonas phage PaP3] Length = 208 Back     alignment and organism information
>gi|167600433|ref|YP_001671933.1| phage particle protein [Pseudomonas phage LUZ24] Length = 208 Back     alignment and organism information
>gi|241760941|ref|ZP_04759030.1| constituent protein [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 219 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00