254781141

254781141

hypothetical protein CLIBASIA_05225

GeneID in NCBI database:8210166Locus tag:CLIBASIA_05225
Protein GI in NCBI database:254781141Protein Accession:YP_003065554.1
Gene range:-(1140043, 1140633)Protein Length:196aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHRRITSQEKAIQKLYQTGSLYDSLEIDFV
ccHHHHHHHHHHHHHHHHHHHcccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHHcccccccEEEccc
cHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHEccccEEEEccccccccccccHHHHHHHHHHHcccccccEEEEcc
MQNQAKILAQSAEALAQLINhhipddssptlektypetYHRIRYLRQKALNIINHFvetgrnpdnIAKELDSEILEKKLIAENQQlehlfpqtkdpaqrENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQKLSedayhkirhkpfvnittnkaknhrrITSQEKAIQKLYQtgslydsleidfv
MQNQAKILAQSAEALAQLINhhipddssptleKTYPETYHRIRYLRQKALNIINHFvetgrnpdnIAKELDSEILEKKLIAENQQLEHlfpqtkdpaqRENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIrhkpfvnittnkaknhrriTSQEKAIQKlyqtgslydsleidfv
MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHRRITSQEKAIQKLYQTGSLYDSLEIDFV
**********SAEALAQLINHHI***********YPETYHRIRYLRQKALNIINHFVETGRN******************AENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQ*******************************************SLYDSLEIDFV
MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHRRITSQEKAIQKLYQTGSLYDSLEIDFV
MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNK*KNHRRITSQEKAIQKLYQTGSLYDSLEIDFV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHRRITSQEKAIQKLYQTGSLYDSLEIDFV
MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHRRITSQEKAIQKLYQTGSLYDSLEIDFV
MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHRRITSQEKAIQKLYQTGSLYDSLEIDFV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target196 hypothetical protein CLIBASIA_05225 [Candidatus Liberib
315122534328 hypothetical protein CKC_03930 [Candidatus Liberibacter 1 2e-68
227822442317 hypothetical protein NGR_c18970 [Sinorhizobium fredii N 1 4e-19
150397034322 hypothetical protein Smed_1831 [Sinorhizobium medicae W 1 1e-17
283856245283 hypothetical protein ZMO0383 [Zymomonas mobilis subsp. 2 2e-04
241760936283 hypothetical protein ZmobDRAFT_0101 [Zymomonas mobilis 2 2e-04
160897388311 hypothetical protein Daci_1945 [Delftia acidovorans SPH 2 0.002
>gi|315122534|ref|YP_004063023.1| hypothetical protein CKC_03930 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 328 Back     alignment and organism information
 Score =  262 bits (670), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 130/198 (65%), Positives = 160/198 (80%), Gaps = 2/198 (1%)

Query: 1   MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETG 60
           +Q QAKILA SA++LAQLINHH+P D  P+L +T P  Y  I  LRQ+ALNIINHFVE G
Sbjct: 131 VQKQAKILAHSADSLAQLINHHMPADPHPSLAQTDPSAYQNIINLRQQALNIINHFVEEG 190

Query: 61  RNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEM 120
           R PD IAKELD+E +E KL  EN+QLE++FPQTKDPAQRE+FF+N+F+IG  +GFQ+EEM
Sbjct: 191 RYPDKIAKELDAEHVEIKLKNENEQLENIFPQTKDPAQRESFFQNIFKIGKKIGFQEEEM 250

Query: 121 VDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAK--NHRRITSQEKAI 178
            +I DHRLL LA+YAQ+GLQSQK+SED Y KIRHKP  +   N+ K  NH RITSQ++AI
Sbjct: 251 KNIIDHRLLVLAHYAQLGLQSQKISEDVYRKIRHKPSGSSVPNRKKSCNHHRITSQQRAI 310

Query: 179 QKLYQTGSLYDSLEIDFV 196
           QKL ++GS YD+L+IDFV
Sbjct: 311 QKLQKSGSFYDALDIDFV 328


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822442|ref|YP_002826414.1| hypothetical protein NGR_c18970 [Sinorhizobium fredii NGR234] Length = 317 Back     alignment and organism information
>gi|150397034|ref|YP_001327501.1| hypothetical protein Smed_1831 [Sinorhizobium medicae WSM419] Length = 322 Back     alignment and organism information
>gi|283856245|ref|YP_162118.2| hypothetical protein ZMO0383 [Zymomonas mobilis subsp. mobilis ZM4] Length = 283 Back     alignment and organism information
>gi|241760936|ref|ZP_04759025.1| hypothetical protein ZmobDRAFT_0101 [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 283 Back     alignment and organism information
>gi|160897388|ref|YP_001562970.1| hypothetical protein Daci_1945 [Delftia acidovorans SPH-1] Length = 311 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00