peg_1074

peg_1074

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(1139359, 1139868)Protein Length:169aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MTIVNNTFITSSSTTNKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEFALVSSQGSEKTSPRKMAALSSWIKKNASRGTGGVLEDMILSLA
cccccccEEEEcccccHHHHHHHHHHHccccccHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHcc
cccccccEEEEEcccccccHHHHHHHccccccccHHHccccccccEEEEEEEHHHcccccccEEccccccccccccccccccEEEEEEEEEEEccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccHHHHHHccc
mtivnntfitsssttnkeslsdvvsritpedtpiysmikkgtthsihpewvvddlaspgpnaqlegdeysfktintpermgnYTQIMRKSwilsgtqeavDDVGYILKYKEQKLKKALEIRKDVEFALVssqgsektsprKMAALSSWIKKnasrgtggvLEDMILSLA
mtivnntfitsssttnkeslsdvvsritpedtpIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGdeysfktintperMGNYTQIMRKSWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEFALvssqgsektsprkMAALSSWikknasrgtggvlEDMILSLA
MtivnntfitsssttnKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEFALVSSQGSEKTSPRKMAALSSWIKKNASRGTGGVLEDMILSLA
*****NTFITSSSTTNKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVD*VGYILKYKEQKLKKALEIRKDVEFALVSSQGS*****RKMAALSSWIKKNASRGTGGVLEDMILSLA
MTIVNNTFITSS***********VSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEFALV**************ALSSWIKKNASRGTGGVLEDMILSLA
***VNNTFITSSSTTNKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEFALVSSQGSEKTSPRKMAALSSWIKKNASRGTGGVLEDMILSLA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIVNNTFITSSSTTNKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEFALVSSQGSEKTSPRKMAALSSWIKKNASRGTGGVLEDMILSLA
MTIVNNTFITSSSTTNKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEFALVSSQGSEKTSPRKMAALSSWIKKNASRGTGGVLEDMILSLA
MTIVNNTFITSSSTTNKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEFALVSSQGSEKTSPRKMAALSSWIKKNASRGTGGVLEDMILSLA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target169
315122533 331 hypothetical protein CKC_03925 [Candidatus Liberibacter 1 2e-75
150397033 331 hypothetical protein Smed_1830 [Sinorhizobium medicae W 1 8e-51
227822441 331 putative phage major head protein [Sinorhizobium fredii 1 3e-47
148257053 320 putative phage major head protein [Bradyrhizobium sp. B 1 3e-23
288817864 291 putative phage major head protein [Hydrogenobacter ther 1 4e-22
163783849 291 hypothetical protein HG1285_12862 [Hydrogenivirga sp. 1 1 8e-20
160897389 306 putative phage major head protein [Delftia acidovorans 1 4e-19
221199511 317 major head protein [Burkholderia multivorans CGD2M] Len 1 4e-17
27476049 317 major head protein [Pseudomonas phage PaP3] Length = 31 1 2e-16
167600435 317 major head protein [Pseudomonas phage LUZ24] Length = 3 1 8e-16
>gi|315122533|ref|YP_004063022.1| hypothetical protein CKC_03925 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 331 Back     alignment and organism information
 Score =  285 bits (728), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 134/160 (83%), Positives = 150/160 (93%)

Query: 1   MTIVNNTFITSSSTTNKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGP 60
           MT + NTFI++SS+TNKESLSDVVSRITPEDTPIYSMIKKG+T SIHPEWVVDDL+SPGP
Sbjct: 1   MTEITNTFISTSSSTNKESLSDVVSRITPEDTPIYSMIKKGSTRSIHPEWVVDDLSSPGP 60

Query: 61  NAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYILKYKEQKLKKALEI 120
           NAQLEGDEYSF++I+TPERMGNYTQIMRKSWILSGTQE++DD G +LKYKEQKLKKALEI
Sbjct: 61  NAQLEGDEYSFESISTPERMGNYTQIMRKSWILSGTQESIDDTGSLLKYKEQKLKKALEI 120

Query: 121 RKDVEFALVSSQGSEKTSPRKMAALSSWIKKNASRGTGGV 160
           RKDVEFALVS+Q SEK SPRK+A+LSSWIK N +RGTGG 
Sbjct: 121 RKDVEFALVSAQESEKKSPRKLASLSSWIKTNVNRGTGGA 160


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397033|ref|YP_001327500.1| hypothetical protein Smed_1830 [Sinorhizobium medicae WSM419] Length = 331 Back     alignment and organism information
>gi|227822441|ref|YP_002826413.1| putative phage major head protein [Sinorhizobium fredii NGR234] Length = 331 Back     alignment and organism information
>gi|148257053|ref|YP_001241638.1| putative phage major head protein [Bradyrhizobium sp. BTAi1] Length = 320 Back     alignment and organism information
>gi|288817864|ref|YP_003432211.1| putative phage major head protein [Hydrogenobacter thermophilus TK-6] Length = 291 Back     alignment and organism information
>gi|163783849|ref|ZP_02178828.1| hypothetical protein HG1285_12862 [Hydrogenivirga sp. 128-5-R1-1] Length = 291 Back     alignment and organism information
>gi|160897389|ref|YP_001562971.1| putative phage major head protein [Delftia acidovorans SPH-1] Length = 306 Back     alignment and organism information
>gi|221199511|ref|ZP_03572555.1| major head protein [Burkholderia multivorans CGD2M] Length = 317 Back     alignment and organism information
>gi|27476049|ref|NP_775251.1| major head protein [Pseudomonas phage PaP3] Length = 317 Back     alignment and organism information
>gi|167600435|ref|YP_001671935.1| major head protein [Pseudomonas phage LUZ24] Length = 317 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00