254781147

254781147

transcriptional regulator

GeneID in NCBI database:8210172Locus tag:CLIBASIA_05270
Protein GI in NCBI database:254781147Protein Accession:YP_003065560.1
Gene range:+(1145968, 1146219)Protein Length:83aa
Gene description:transcriptional regulator
COG prediction:[K] Predicted transcriptional regulators
KEGG prediction:transcriptional regulator
SEED prediction:transcriptional regulator
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80---
MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLKP
ccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHcc
cccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHccc
mprrkrdephlsDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISEletgkstinidNMIILAHTLdtplwkllkp
mprrkrdephlsdailrermifvnNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHtldtplwkllkp
MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLKP
********************IFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLKP
*********HLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLKP
********P*LSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLKP
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLKP
MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLKP
MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLLKP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target83 transcriptional regulator [Candidatus Liberibacter asia
31512253983 transcriptional regulator [Candidatus Liberibacter sola 1 6e-37
32591953585 putative transcriptional regulator [Xanthomonas gardner 1 6e-17
32591759785 putative transcriptional regulator [Xanthomonas vesicat 1 1e-16
1095671286 transcriptional regulator [Xylella fastidiosa 9a5c] Len 1 7e-15
11432657885 XRE family transcriptional regulator [Nitrosomonas eutr 1 2e-10
312113854101 helix-turn-helix domain protein [Rhodomicrobium vanniel 1 2e-08
3244217398 putative mating pair formation protein [Stenotrophomona 1 2e-08
312115518101 helix-turn-helix domain protein [Rhodomicrobium vanniel 1 3e-08
312114516101 helix-turn-helix domain protein [Rhodomicrobium vanniel 1 4e-08
2780247672 unknown [Rhizobium leguminosarum bv. viciae] Length = 7 1 3e-05
>gi|315122539|ref|YP_004063028.1| transcriptional regulator [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 83 Back     alignment and organism information
 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 80/83 (96%)

Query: 1  MPRRKRDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKST 60
          MPRR++DE HLS+ ILRERMIFVNNFRN RKEAK+TQKEIRNRTGFAQSWISELETGKST
Sbjct: 1  MPRRRKDESHLSNTILRERMIFVNNFRNTRKEAKITQKEIRNRTGFAQSWISELETGKST 60

Query: 61 INIDNMIILAHTLDTPLWKLLKP 83
          INIDNMIILAHTL+TPLWKLLKP
Sbjct: 61 INIDNMIILAHTLNTPLWKLLKP 83


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325919535|ref|ZP_08181552.1| putative transcriptional regulator [Xanthomonas gardneri ATCC 19865] Length = 85 Back     alignment and organism information
>gi|325917597|ref|ZP_08179796.1| putative transcriptional regulator [Xanthomonas vesicatoria ATCC 35937] Length = 85 Back     alignment and organism information
>gi|10956712|ref|NP_061657.1| transcriptional regulator [Xylella fastidiosa 9a5c] Length = 86 Back     alignment and organism information
>gi|114326578|ref|YP_743737.1| XRE family transcriptional regulator [Nitrosomonas eutropha C91] Length = 85 Back     alignment and organism information
>gi|312113854|ref|YP_004011450.1| helix-turn-helix domain protein [Rhodomicrobium vannielii ATCC 17100] Length = 101 Back     alignment and organism information
>gi|32442173|gb|AAP82048.1| putative mating pair formation protein [Stenotrophomonas maltophilia] Length = 98 Back     alignment and organism information
>gi|312115518|ref|YP_004013114.1| helix-turn-helix domain protein [Rhodomicrobium vannielii ATCC 17100] Length = 101 Back     alignment and organism information
>gi|312114516|ref|YP_004012112.1| helix-turn-helix domain protein [Rhodomicrobium vannielii ATCC 17100] Length = 101 Back     alignment and organism information
>gi|27802476|gb|AAO21114.1| unknown [Rhizobium leguminosarum bv. viciae] Length = 72 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target83 transcriptional regulator [Candidatus Liberibacter asia
smart0053056 smart00530, HTH_XRE, Helix-turn-helix XRE-family like p 2e-06
pfam0138155 pfam01381, HTH_3, Helix-turn-helix 2e-05
TIGR0307058 TIGR03070, couple_hipB, transcriptional regulator, y4mF 2e-04
PRK13890120 PRK13890, PRK13890, conjugal transfer protein TrbA; Pro 3e-04
cd0009358 cd00093, HTH_XRE, Helix-turn-helix XRE-family like prot 1e-06
>gnl|CDD|128803 smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>gnl|CDD|144828 pfam01381, HTH_3, Helix-turn-helix Back     alignment and domain information
>gnl|CDD|163124 TIGR03070, couple_hipB, transcriptional regulator, y4mF family Back     alignment and domain information
>gnl|CDD|184374 PRK13890, PRK13890, conjugal transfer protein TrbA; Provisional Back     alignment and domain information
>gnl|CDD|28977 cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 83 transcriptional regulator [Candidatus Liberibacter asia
PRK09943 185 DNA-binding transcriptional repressor PuuR; Provisional 99.67
PHA0197667 helix-turn-helix protein 99.58
PRK13890119 conjugal transfer protein TrbA; Provisional 99.57
PRK09706135 transcriptional repressor DicA; Reviewed 99.54
TIGR0307058 couple_hipB transcriptional regulator, y4mF family. Mem 99.45
PRK08154 304 anaerobic benzoate catabolism transcriptional regulator 99.35
smart0053056 HTH_XRE Helix-turn-helix XRE-family like proteins. 99.31
pfam0138155 HTH_3 Helix-turn-helix. This large family of DNA bindin 99.31
COG147668 Predicted transcriptional regulators [Transcription] 99.27
PRK0972688 DNA-binding transcriptional regulator HipB; Provisional 99.15
PRK06424144 transcription factor; Provisional 99.14
cd0009358 HTH_XRE Helix-turn-helix XRE-family like proteins. Prok 99.13
PRK08359175 transcription factor; Validated 99.06
COG3620 187 Predicted transcriptional regulator with C-terminal CBS 98.96
COG1813165 Predicted transcription factor, homolog of eukaryotic M 98.96
PRK04140 319 hypothetical protein; Provisional 98.73
TIGR00270169 TIGR00270 conserved hypothetical protein TIGR00270; Int 98.64
TIGR02612150 mob_myst_A mobile mystery protein A; InterPro: IPR01343 98.52
COG1395 313 Predicted transcriptional regulator [Transcription] 98.34
TIGR0260781 antidote_HigA addiction module antidote protein, HigA f 98.28
COG1709 241 Predicted transcriptional regulator [Transcription] 98.26
COG365573 Predicted transcriptional regulator [Transcription] 98.24
COG1426 284 Predicted transcriptional regulator contains Xre-like H 98.22
KOG3398135 consensus 98.22
PRK13355 518 bifunctional HTH-domain containing protein/aminotransfe 98.08
COG1396120 HipB Predicted transcriptional regulators [Transcriptio 98.02
COG3093104 VapI Plasmid maintenance system antidote protein [Gener 98.01
PRK10856 332 hypothetical protein; Provisional 97.98
COG2944104 Predicted transcriptional regulator [Transcription] 97.89
PRK1007296 putative transcriptional regulator; Provisional 97.67
TIGR0268491 dnstrm_HI1420 probable addiction module antidote protei 97.54
COG5499120 Predicted transcription regulator containing HTH domain 97.41
KOG3802 398 consensus 97.39
COG4800170 Predicted transcriptional regulator with an HTH domain 97.33
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 97.27
PHA0054282 putative Cro-like protein 97.04
pfam08667146 BetR BetR domain. This family includes an N-terminal he 96.98
pfam0015775 Pou Pou domain - N-terminal to homeobox domain. 96.96
COG560691 Uncharacterized conserved small protein [Function unkno 96.92
pfam0702265 Phage_CI_repr Bacteriophage CI repressor helix-turn-hel 96.8
PRK10014 342 DNA-binding transcriptional repressor MalI; Provisional 96.76
PRK09526 342 lacI lac repressor; Reviewed 96.66
PRK02866147 cyanate hydratase; Validated 96.63
TIGR02846228 spore_sigmaK RNA polymerase sigma-K factor; InterPro: I 96.58
PRK09492 315 treR trehalose repressor; Provisional 96.55
COG2522119 Predicted transcriptional regulator [General function p 96.46
PRK11303 330 DNA-binding transcriptional regulator FruR; Provisional 96.25
pfam0035646 LacI Bacterial regulatory proteins, lacI family. 96.09
PRK10401 346 DNA-binding transcriptional regulator GalS; Provisional 96.07
PRK10727 342 DNA-binding transcriptional regulator GalR; Provisional 95.96
smart0035470 HTH_LACI helix_turn _helix lactose operon repressor. 95.87
PRK08099 411 nicotinamide-nucleotide adenylyltransferase; Provisiona 95.82
COG3636100 Predicted transcriptional regulator [Transcription] 95.78
KOG1168385 consensus 95.78
PRK11041 341 DNA-binding transcriptional regulator CytR; Provisional 95.74
PRK10703 335 DNA-binding transcriptional repressor PurR; Provisional 95.68
COG1609 333 PurR Transcriptional regulators [Transcription] 95.64
COG2390 321 DeoR Transcriptional regulator, contains sigma factor-r 95.49
PRK10339 327 DNA-binding transcriptional repressor EbgR; Provisional 95.39
TIGR02980229 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subf 95.35
PRK08558 238 adenine phosphoribosyltransferase; Provisional 95.12
PRK03975139 tfx putative transcriptional regulator; Provisional 95.05
COG342382 Nlp Predicted transcriptional regulator [Transcription] 94.64
COG1191247 FliA DNA-directed RNA polymerase specialized sigma subu 94.63
TIGR00673156 cynS cyanate hydratase; InterPro: IPR008076 Cyanase, an 94.46
PRK10423 327 transcriptional repressor RbsR; Provisional 94.3
pfam04814177 HNF-1_N Hepatocyte nuclear factor 1 (HNF-1), N terminus 94.25
cd0139252 HTH_LacI Helix-turn-helix (HTH) DNA binding domain of t 93.97
TIGR00721142 tfx DNA-binding protein, Tfx family; InterPro: IPR00464 93.86
PRK1034490 DNA-binding transcriptional regulator Nlp; Provisional 93.69
TIGR02885231 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR 93.37
COG1356143 tfx Transcriptional regulator [DNA replication, recombi 93.34
TIGR02835234 spore_sigmaE RNA polymerase sigma-E factor; InterPro: I 92.84
pfam0454550 Sigma70_r4 Sigma-70, region 4. Region 4 of sigma-70 lik 92.81
COG1513151 CynS Cyanate lyase [Inorganic ion transport and metabol 92.67
PRK08301239 sporulation sigma factor SigE; Reviewed 91.96
PRK12427229 flagellar biosynthesis sigma factor; Provisional 91.55
PRK07122263 RNA polymerase sigma factor SigF; Reviewed 91.4
PRK05572251 sporulation sigma factor SigF; Validated 90.97
PRK08583257 RNA polymerase sigma factor SigB; Validated 90.9
COG2973103 TrpR Trp operon repressor [Transcription] 90.81
TIGR02147 281 Fsuc_second hypothetical protein, TIGR02147; InterPro: 90.7
TIGR01950142 SoxR redox-sensitive transcriptional activator SoxR; In 90.52
PRK06288261 RNA polymerase sigma factor WhiG; Reviewed 90.35
PRK08215257 sporulation sigma factor SigG; Reviewed 90.34
TIGR02405 311 trehalos_R_Ecol trehalose operon repressor; InterPro: I 90.06
TIGR0132195 TrpR trp operon repressor; InterPro: IPR013335 The Trp 94.43
pfam0137188 Trp_repressor Trp repressor protein. This protein binds 94.26
pfam02001100 DUF134 Protein of unknown function DUF134. This family 91.92
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 90.94
TIGR02937162 sigma70-ECF RNA polymerase sigma factor, sigma-70 famil 90.38
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>PRK13890 conjugal transfer protein TrbA; Provisional Back     alignment and domain information
>PRK09706 transcriptional repressor DicA; Reviewed Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>pfam01381 HTH_3 Helix-turn-helix Back     alignment and domain information
>COG1476 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK09726 DNA-binding transcriptional regulator HipB; Provisional Back     alignment and domain information
>PRK06424 transcription factor; Provisional Back     alignment and domain information
>cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>PRK08359 transcription factor; Validated Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription] Back     alignment and domain information
>PRK04140 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00270 TIGR00270 conserved hypothetical protein TIGR00270; InterPro: IPR004451 This family of conserved hypothetical proteins includes proteins of unknown function from archaebacteria Back     alignment and domain information
>TIGR02612 mob_myst_A mobile mystery protein A; InterPro: IPR013435 Proteins in this entry are more often encoded within mobilisation-related contexts than not Back     alignment and domain information
>COG1395 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family; InterPro: IPR013430 Proteins in this entry form a distinct group of helix-turn-helix proteins, which are strictly bacterial and nearly always shorter than 110 amino acids Back     alignment and domain information
>COG1709 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG3655 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1426 Predicted transcriptional regulator contains Xre-like HTH domain [Function unknown] Back     alignment and domain information
>KOG3398 consensus Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>COG1396 HipB Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG3093 VapI Plasmid maintenance system antidote protein [General function prediction only] Back     alignment and domain information
>PRK10856 hypothetical protein; Provisional Back     alignment and domain information
>COG2944 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10072 putative transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02684 dnstrm_HI1420 probable addiction module antidote protein; InterPro: IPR014057 Members of this strictly bacterial protein family are small, at roughly 100 amino acids Back     alignment and domain information
>COG5499 Predicted transcription regulator containing HTH domain [Transcription] Back     alignment and domain information
>KOG3802 consensus Back     alignment and domain information
>COG4800 Predicted transcriptional regulator with an HTH domain [Transcription] Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>pfam08667 BetR BetR domain Back     alignment and domain information
>pfam00157 Pou Pou domain - N-terminal to homeobox domain Back     alignment and domain information
>COG5606 Uncharacterized conserved small protein [Function unknown] Back     alignment and domain information
>pfam07022 Phage_CI_repr Bacteriophage CI repressor helix-turn-helix domain Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PRK02866 cyanate hydratase; Validated Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor; InterPro: IPR014209 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>COG2522 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>pfam00356 LacI Bacterial regulatory proteins, lacI family Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>smart00354 HTH_LACI helix_turn _helix lactose operon repressor Back     alignment and domain information
>PRK08099 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>COG3636 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1168 consensus Back     alignment and domain information
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; InterPro: IPR014322 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>COG3423 Nlp Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>TIGR00673 cynS cyanate hydratase; InterPro: IPR008076 Cyanase, an enzyme found in bacteria and plants, catalyses the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide, allowing the host organisms to overcome the toxicity of environmental cyanate Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>pfam04814 HNF-1_N Hepatocyte nuclear factor 1 (HNF-1), N terminus Back     alignment and domain information
>cd01392 HTH_LacI Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family; InterPro: IPR004645 This is a family of Tfx DNA-binding proteins, which is restricted to the archaea Back     alignment and domain information
>PRK10344 DNA-binding transcriptional regulator Nlp; Provisional Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR014236 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG1356 tfx Transcriptional regulator [DNA replication, recombination and repair] Back     alignment and domain information
>TIGR02835 spore_sigmaE RNA polymerase sigma-E factor; InterPro: IPR014200 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>pfam04545 Sigma70_r4 Sigma-70, region 4 Back     alignment and domain information
>COG1513 CynS Cyanate lyase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>PRK12427 flagellar biosynthesis sigma factor; Provisional Back     alignment and domain information
>PRK07122 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>COG2973 TrpR Trp operon repressor [Transcription] Back     alignment and domain information
>TIGR02147 Fsuc_second hypothetical protein, TIGR02147; InterPro: IPR011873 This family consists of the 40 members of a paralogous protein family in the rumen anaerobe Fibrobacter succinogenes S85 Back     alignment and domain information
>TIGR01950 SoxR redox-sensitive transcriptional activator SoxR; InterPro: IPR010211 SoxR is a MerR-family homodimeric transcription factor with a 2Fe-2S cluster in each monomer Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK08215 sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor; InterPro: IPR012771 Trehalose is a non-reducing disaccharide which can be used as both a carbon source and an osmoprotectant in bacteria Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor; InterPro: IPR013335 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>pfam01371 Trp_repressor Trp repressor protein Back     alignment and domain information
>pfam02001 DUF134 Protein of unknown function DUF134 Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family; InterPro: IPR014284 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target83 transcriptional regulator [Candidatus Liberibacter asia
1y7y_A74 High-Resolution Crystal Structure Of The Restrictio 8e-08
2b5a_A77 C.Bcli, Control Element Of The Bcli Restriction- Mo 1e-07
1b0n_A111 Sinr ProteinSINI PROTEIN COMPLEX Length = 111 2e-06
3ivp_A126 The Structure Of A Possible Transposon-Related Dna- 9e-06
1adr_A76 Determination Of The Nuclear Magnetic Resonance Str 4e-05
3jxb_C67 Crystal Structure Of The P22 C2 Repressor Protein I 5e-05
2r1j_L68 Crystal Structure Of The P22 C2 Repressor Protein I 9e-05
1utx_A66 Regulation Of Cytolysin Expression By Enterococcus 1e-04
2xj3_A66 High Resolution Structure Of The T55c Mutant Of Cyl 1e-04
1y9q_A 192 Crystal Structure Of Hth_3 Family Transcriptional R 1e-04
2qfc_A 293 Crystal Structure Of Bacillus Thuringiensis Plcr Co 1e-04
2p5t_A158 Molecular And Structural Characterization Of The Pe 2e-04
3omt_A73 Putative Antitoxin Component, Chu_2935 Protein, Fro 3e-04
>gi|61680543|pdb|1Y7Y|A Chain A, High-Resolution Crystal Structure Of The Restriction- Modification Controller Protein C.Ahdi From Aeromonas Hydrophila Length = 74 Back     alignment and structure
 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 31/60 (51%)

Query: 22 FVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLL 81
          F    R +R    L+Q+ +   +G  +S++  +E G+  +++ N++ LA  LD    +L 
Sbjct: 14 FGQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPRELF 73


>gi|85544221|pdb|2B5A|A Chain A, C.Bcli, Control Element Of The Bcli Restriction- Modification System Length = 77 Back     alignment and structure
gi|4389349|pdb|1B0N|A Chain A, Sinr ProteinSINI PROTEIN COMPLEX Length = 111 Back     alignment and structure
>gi|259090355|pdb|3IVP|A Chain A, The Structure Of A Possible Transposon-Related Dna-Binding Protein From Clostridium Difficile 630. Length = 126 Back     alignment and structure
>gi|157829815|pdb|1ADR|A Chain A, Determination Of The Nuclear Magnetic Resonance Structure Of The Dna-Binding Domain Of The P22 C2 Repressor (1-76) In Solution And Comparison With The Dna-Binding Domain Of The 434 Repressor Length = 76 Back     alignment and structure
>gi|284055653|pdb|3JXB|C Chain C, Crystal Structure Of The P22 C2 Repressor Protein In Complex With Synthetic Operator 9c Length = 67 Back     alignment and structure
>gi|186972781|pdb|2R1J|L Chain L, Crystal Structure Of The P22 C2 Repressor Protein In Complex With The Synthetic Operator 9t Length = 68 Back     alignment and structure
gi|55670390|pdb|1UTX|A Chain A, Regulation Of Cytolysin Expression By Enterococcus Faecalis: Role Of Cylr2 Length = 66 Back     alignment and structure
>gi|322812212|pdb|2XJ3|A Chain A, High Resolution Structure Of The T55c Mutant Of Cylr2. Length = 66 Back     alignment and structure
>gi|60594530|pdb|1Y9Q|A Chain A, Crystal Structure Of Hth_3 Family Transcriptional Regulator From Vibrio Cholerae Length = 192 Back     alignment and structure
>gi|160285873|pdb|2QFC|A Chain A, Crystal Structure Of Bacillus Thuringiensis Plcr Complexed With Papr Length = 293 Back     alignment and structure
gi|149242896|pdb|2P5T|A Chain A, Molecular And Structural Characterization Of The Pezat Chromosomal Toxin-Antitoxin System Of The Human Pathogen Streptococcus Pneumoniae Length = 158 Back     alignment and structure
>gi|306440751|pdb|3OMT|A Chain A, Putative Antitoxin Component, Chu_2935 Protein, From Xre Family From Prevotella Buccae. Length = 73 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target83 transcriptional regulator [Candidatus Liberibacter asia
3kxa_A141 NGO0477 protein, putative uncharacterized protein; NEW 9e-08
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, transcri 1e-07
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCSG, pr 1e-07
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1.54A 1e-07
1adr_A76 P22 C2 repressor; transcription regulation; NMR {Bacter 7e-07
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-turn-h 7e-07
2wiu_B88 HTH-type transcriptional regulator HIPB; transferase tr 1e-06
3mlf_A111 Transcriptional regulator; structural genomics, helix-t 1e-06
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, DNA- 2e-06
2p5t_A158 Putative transcriptional regulator PEZA; postsegregatio 2e-06
1utx_A66 CYLR2; DNA-binding protein, transcriptional repressor, 2e-06
1y9q_A 192 Transcriptional regulator, HTH_3 family; transcriptiona 5e-06
3kz3_A80 Repressor protein CI; five helix bundle, DNA-binding, t 2e-05
3omt_A73 Uncharacterized protein; structural genomics, PSI-2, pr 2e-05
1r69_A69 Repressor protein CI; gene regulating protein; 2.00A {P 2e-05
1x57_A91 Endothelial differentiation-related factor 1; HMBF1alph 2e-05
3op9_A114 PLI0006 protein; structural genomics, PSI-2, protein st 3e-05
1lmb_392 Protein (lambda repressor); protein-DNA complex, double 3e-05
2bnm_A 198 Epoxidase; oxidoreductase, cupin, HTH, cation-dependant 4e-05
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA binding 5e-05
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-turn-h 9e-05
3gn5_A133 HTH-type transcriptional regulator MQSA (YGIT/B3021); Z 1e-04
2qfc_A 293 PLCR protein; TPR, HTH, transcription regulation; 2.60A 1e-04
2auw_A170 Hypothetical protein NE0471; alpha-beta structure, stru 1e-04
1zug_A71 Phage 434 CRO protein; gene regulating protein, transcr 2e-04
3ivp_A126 Putative transposon-related DNA-binding protein; APC626 2e-04
3clc_A82 Regulatory protein; protein-DNA complex, transcriptiona 2e-04
3g5g_A99 Regulatory protein; transcriptional regulator, helix-tu 2e-04
1b0n_A111 Protein (SINR protein); transcription regulator, antago 2e-04
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif 2e-04
2awi_A 317 PRGX; repressor, pheromone, DNA binding, regulatory dom 3e-04
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG, GFT 3e-04
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; HTH- 4e-04
3bdn_A 236 Lambda repressor; repressor, allostery; HET: DNA; 3.91A 0.001
3g7d_A 443 PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic 0.002
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, protein binding, 0.003
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, structural genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Length = 141 Back     alignment and structure
 Score = 50.3 bits (120), Expect = 9e-08
 Identities = 20/85 (23%), Positives = 36/85 (42%), Gaps = 6/85 (7%)

Query: 2   PRRK----RDEPHLSDAILRERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETG 57
           PRRK    R    ++D I  +       F ++R +   TQ E+    G  Q ++S +E  
Sbjct: 47  PRRKAAMDRAAARIADKIALKA--GGETFVSLRMKKGFTQSELATAAGLPQPYLSRIENS 104

Query: 58  KSTINIDNMIILAHTLDTPLWKLLK 82
           K ++    +  LA+ L     ++  
Sbjct: 105 KQSLQDKTVQKLANALGVSPLEVRA 129


>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Length = 74 Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomics; 1.80A {Silicibacter pomeroyi} Length = 86 Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Length = 77 Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Bacteriophage P22} SCOP: a.35.1.2 Length = 76 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 Length = 68 Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, bacterial persistence, serine kinase, mercury derivative, SAD; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Length = 88 Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Length = 111 Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Length = 99 Back     alignment and structure
>2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, helix-turn-helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae TIGR4} Length = 158 Back     alignment and structure
>1utx_A CYLR2; DNA-binding protein, transcriptional repressor, regulation of cytolysin operon, helix-turn-helix; 1.90A {Enterococcus faecalis} SCOP: a.35.1.3 PDB: 2gzu_A Length = 66 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Length = 192 Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Length = 80 Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Length = 73 Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Length = 69 Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Length = 91 Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Length = 114 Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Length = 92 Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A Length = 198 Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response element family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Length = 83 Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Length = 84 Back     alignment and structure
>3gn5_A HTH-type transcriptional regulator MQSA (YGIT/B3021); Zn-binding protein, HTH-XRE DNA binding motif, DNA-binding, transcription regulation; HET: MEQ; 2.15A {Escherichia coli k-12} PDB: 3gn5_B* Length = 133 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovarisraelensis atcc 35646} Length = 293 Back     alignment and structure
>2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein structure initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1 Length = 170 Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Length = 71 Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile 630} Length = 126 Back     alignment and structure
>3clc_A Regulatory protein; protein-DNA complex, transcriptional regulator, helix-turn- helix, DNA-bending, plasmid, transcription regulator/DNA complex; 2.80A {Enterobacter SP} Length = 82 Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Length = 99 Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 Length = 111 Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Length = 99 Back     alignment and structure
>2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A Length = 317 Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Length = 94 Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* Length = 133 Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Length = 236 Back     alignment and structure
>3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A Length = 443 Back     alignment and structure
>2jvl_A TRMBF1; coactivator, helix-turn-helix, protein binding, transcription; NMR {Trichoderma reesei} Length = 107 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target83 transcriptional regulator [Candidatus Liberibacter asia
2bnm_A 198 Epoxidase; oxidoreductase, cupin, HTH, cation-dependant 99.64
1y9q_A 192 Transcriptional regulator, HTH_3 family; transcriptiona 99.61
3ivp_A126 Putative transposon-related DNA-binding protein; APC626 99.58
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-binding dom 99.57
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1.54A 99.57
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, tran 99.56
3op9_A114 PLI0006 protein; structural genomics, PSI-2, protein st 99.55
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2, MCS 99.55
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG, GFT 99.55
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, transcri 99.55
3g5g_A99 Regulatory protein; transcriptional regulator, helix-tu 99.53
3clc_A82 Regulatory protein; protein-DNA complex, transcriptiona 99.52
1b0n_A111 Protein (SINR protein); transcription regulator, antago 99.52
1lmb_392 Protein (lambda repressor); protein-DNA complex, double 99.5
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA binding 99.5
3kxa_A141 NGO0477 protein, putative uncharacterized protein; NEW 99.5
2ofy_A86 Putative XRE-family transcriptional regulator; transcri 99.5
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-turn-h 99.49
3kz3_A80 Repressor protein CI; five helix bundle, DNA-binding, t 99.48
2a6c_A83 Helix-turn-helix motif; putative transcriptional regula 99.48
1utx_A66 CYLR2; DNA-binding protein, transcriptional repressor, 99.48
1adr_A76 P22 C2 repressor; transcription regulation; NMR {Entero 99.48
2p5t_A158 Putative transcriptional regulator PEZA; postsegregatio 99.47
3mlf_A111 Transcriptional regulator; structural genomics, helix-t 99.46
2wiu_B88 HTH-type transcriptional regulator HIPB; transferase tr 99.45
3omt_A73 Uncharacterized protein; structural genomics, PSI-2, pr 99.45
3bs3_A76 Putative DNA-binding protein; XRE-family, structural ge 99.44
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding, tra 99.41
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCSG, pr 99.41
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genomics, 99.41
1x57_A91 Endothelial differentiation-related factor 1; HMBF1alph 99.4
1r69_A69 Repressor protein CI; gene regulating protein; 2.00A {P 99.39
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-turn-h 99.37
1zug_A71 Phage 434 CRO protein; gene regulating protein, transcr 99.37
3cec_A104 Putative antidote protein of plasmid maintenance system 99.34
3g7d_A 443 PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic 99.32
2awi_A 317 PRGX; repressor, pheromone, DNA binding, regulatory dom 99.3
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, DNA- 99.26
3bdn_A 236 Lambda repressor; repressor, allostery; HET: DNA; 3.91A 99.23
2qfc_A 293 PLCR protein; TPR, HTH, transcription regulation; 2.60A 99.23
2wus_R112 RODZ, putative uncharacterized protein; structural prot 99.11
2o38_A120 Hypothetical protein; alpha-beta, helix-turn-helix, str 99.08
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B3021); h 99.07
2eby_A113 Putative HTH-type transcriptional regulator YBAQ; hypot 98.97
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif 98.93
2fjr_A 189 Repressor protein CI; genetic switch, regulation, coope 98.86
3fym_A130 Putative uncharacterized protein; HTH DNA binding, DNA 98.82
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; HTH- 98.81
2auw_A170 Hypothetical protein NE0471; alpha-beta structure, stru 98.66
1dw9_A156 Cyanate lyase; cyanate degradation, structural genomics 98.38
3bd1_A79 CRO protein; transcription factor, helix-turn-helix, pr 96.47
3kjx_A 344 Transcriptional regulator, LACI family; LACL family, pr 96.44
2k9q_A77 Uncharacterized protein; all helix, helix-turn-helix, p 96.43
1neq_A74 DNA-binding protein NER; NMR {Enterobacteria phage MU} 96.31
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding protein, L 96.26
2hsg_A 332 Glucose-resistance amylase regulator; CCPA, transcripti 96.1
3h5t_A 366 Transcriptional regulator, LACI family; DNA-dependent, 95.98
2h8r_A 221 Hepatocyte nuclear factor 1-beta; trasncription factor, 95.63
1qpz_A 340 PURA, protein (purine nucleotide synthesis repressor); 95.61
3e3m_A 355 Transcriptional regulator, LACI family; structural geno 95.12
3bil_A 348 Probable LACI-family transcriptional regulator; structu 94.67
2w48_A 315 Sorbitol operon regulator; SORC, activator, repressor, 94.62
3dbi_A 338 Sugar-binding transcriptional regulator, LACI family; s 94.32
3h5o_A 339 Transcriptional regulator GNTR; transcription regulator 94.26
1jye_A 349 Lactose operon repressor; gene regulation, protein stab 94.17
2o20_A 332 Catabolite control protein A; CCPA, transcriptional reg 93.7
3jvd_A 333 Transcriptional regulators; structural genomics, PSI-2, 93.21
2ox6_A166 Hypothetical protein SO3848; structural genomics, PSI-2 93.19
2oi8_A 216 Putative regulatory protein SCO4313; TETR, structural g 93.13
3mky_B189 Protein SOPB; partition, F plasmid, centromere, DNA bin 93.08
3ctp_A 330 Periplasmic binding protein/LACI transcriptional regula 92.83
2csf_A101 DNA-binding protein SATB2; CUT domain, special AT-rich 92.35
1ui5_A 215 A-factor receptor homolog; helix-turn-helix, alpha-heli 92.34
3mvp_A 217 TETR/ACRR transcriptional regulator; PSI, MCSG, structu 92.2
1zs4_A83 Regulatory protein CII; helix-turn-helix, transcription 92.06
3d1n_I151 POU domain, class 6, transcription factor 1; protein-DN 91.85
2o0m_A 345 Transcriptional regulator, SORC family; structural geno 91.63
3kz9_A 206 SMCR; transcriptional regulator, quorum S DNA-binding, 91.43
3gzi_A 218 Transcriptional regulator, TETR family; TETR family tra 91.35
1ic8_A 194 Hepatocyte nuclear factor 1-alpha; transcription regula 90.71
1t56_A 216 EThr repressor; helix-turn-helix, TETR family, dimer, t 90.66
1zx4_A 192 P1 PARB, plasmid partition PAR B protein, PARB; transla 95.92
1jhf_A 202 LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {E 93.78
1jhg_A101 Trp operon repressor; complex (regulatory protein/pepti 93.65
3frw_A107 Putative Trp repressor protein; structural genomics, AP 93.47
3kor_A119 Possible Trp repressor; putative DNA-binding Trp repres 93.27
1r71_A178 Transcriptional repressor protein KORB; INCP, plasmid p 92.56
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein struct 91.79
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A Back     alignment and structure
Probab=99.64  E-value=3.6e-16  Score=115.52  Aligned_cols=64  Identities=19%  Similarity=0.330  Sum_probs=60.8

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCC-CCCCHHHHHHHHHHHCCCHHHHCCC
Q ss_conf             999999999999839949999998634299998875589-9944899999999928999996088
Q gi|254781147|r   20 MIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGK-STINIDNMIILAHTLDTPLWKLLKP   83 (83)
Q Consensus        20 ~~~g~~ir~~R~~~gltq~ela~~~gis~~~is~iE~G~-~~~~~~~l~~la~al~i~~~~l~~P   83 (83)
                      ..||.+||.+|+++||||++||+++|+|+++||+||+|+ .+|++.+|.+||++|+|++.+||.+
T Consensus         9 ~~lg~rir~lR~~~gltl~eLA~~~GvS~~~lS~iE~G~~~~psl~~L~kia~aL~v~~~~l~~~   73 (198)
T 2bnm_A            9 TGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPP   73 (198)
T ss_dssp             HHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTTCTTCBHHHHHHHHHHTTSCTGGGSCC
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCHHHHCCC
T ss_conf             99999999999985999999998879799999986738988998999999999979799998186



>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile 630} Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor A3} Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional activator, human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Back     alignment and structure
>3clc_A Regulatory protein; protein-DNA complex, transcriptional regulator, helix-turn- helix, DNA-bending, plasmid, transcription regulator/DNA complex; 2.80A {Enterobacter SP} Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response element family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PSI, protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>1utx_A CYLR2; DNA-binding protein, transcriptional repressor, regulation of cytolysin operon, helix-turn-helix; 1.90A {Enterococcus faecalis} SCOP: a.35.1.3 PDB: 2gzu_A Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, helix-turn-helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, bacterial persistence, serine kinase, mercury derivative, SAD; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomics; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli CFT073} SCOP: a.35.1.3 PDB: 2icp_A Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>3cec_A Putative antidote protein of plasmid maintenance system; ZP_00107635.1, structural genomics, joint center for structural genomics; HET: MSE; 1.60A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A Back     alignment and structure
>2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovarisraelensis atcc 35646} Back     alignment and structure
>2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima} Back     alignment and structure
>2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.83A {Rhodopseudomonas palustris CGA009} SCOP: a.35.1.13 Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Back     alignment and structure
>2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A Back     alignment and structure
>3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* Back     alignment and structure
>2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein structure initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1 Back     alignment and structure
>1dw9_A Cyanate lyase; cyanate degradation, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SO4; 1.65A {Escherichia coli} SCOP: a.35.1.4 d.72.1.1 PDB: 1dwk_A* 2ivq_A 2ivb_A 2iu7_A 2iv1_A 2iuo_A 2ivg_A Back     alignment and structure
>3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution; 1.40A {Xylella fastidiosa ann-1} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transcription regulation; NMR {Escherichia coli K12} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI family; structural genomics, protein structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix; 1.90A {Lactococcus lactis} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcription regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2ox6_A Hypothetical protein SO3848; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics; 1.70A {Shewanella oneidensis mr-1} SCOP: a.35.1.6 Back     alignment and structure
>2oi8_A Putative regulatory protein SCO4313; TETR, structural genomics, PSI-2, protein structure initiative; 2.50A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3mky_B Protein SOPB; partition, F plasmid, centromere, DNA binding protein- complex; HET: DNA; 2.86A {Escherichia coli} PDB: 3mkw_B* 3mkz_A* Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional regulator; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens qymf} Back     alignment and structure
>2csf_A DNA-binding protein SATB2; CUT domain, special AT-rich sequence-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.7 Back     alignment and structure
>1ui5_A A-factor receptor homolog; helix-turn-helix, alpha-helix-bundle, antibiotic; 2.40A {Streptomyces coelicolor A3} SCOP: a.4.1.9 a.121.1.1 PDB: 1ui6_A Back     alignment and structure
>3mvp_A TETR/ACRR transcriptional regulator; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 1.85A {Streptococcus mutans} Back     alignment and structure
>1zs4_A Regulatory protein CII; helix-turn-helix, transcription activator, transcription/DNA complex; HET: DNA; 1.70A {Enterobacteria phage lambda} SCOP: a.35.1.9 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, PSI-2, protein structure initiative; 1.60A {Enterococcus faecalis V583} SCOP: c.124.1.8 Back     alignment and structure
>3kz9_A SMCR; transcriptional regulator, quorum S DNA-binding, transcription regulation, transcription regula; HET: MSE; 2.10A {Vibrio vulnificus} PDB: 2pbx_A Back     alignment and structure
>3gzi_A Transcriptional regulator, TETR family; TETR family transcriptional regulator, structural genomics, center for structural genomics, JCSG; 2.05A {Shewanella loihica pv-4} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1t56_A EThr repressor; helix-turn-helix, TETR family, dimer, transcription; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: a.4.1.9 a.121.1.1 PDB: 3g1m_A* 1u9n_A* 1u9o_A* Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 1jhc_A 1jhe_A 1lea_A 1leb_A Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein/peptide), DNA-binding regulatory protein; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 1trr_A* 1tro_A* Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, protein structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1 Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 83 transcriptional regulator [Candidatus Liberibacter asia
d1y7ya169 a.35.1.3 (A:5-73) Restriction-modification controller p 4e-08
d2b5aa177 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus c 1e-07
d2r1jl166 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain 3e-07
d1utxa_66 a.35.1.3 (A:) Putative transcription regulator CylR2 {E 5e-07
d1y9qa179 a.35.1.8 (A:4-82) Probable transcriptional regulator VC 2e-06
d1b0na268 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {B 4e-06
d2croa_65 a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712] 6e-05
d1r69a_63 a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bac 2e-04
d2ppxa162 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agr 6e-04
d2o38a189 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhod 6e-04
d1lmb3_87 a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain { 0.002
d2auwa167 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-term 0.003
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Length = 69 Back     information, alignment and structure

class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: SinR domain-like
domain: Restriction-modification controller protein C.AhdI
species: Aeromonas hydrophila [TaxId: 644]
 Score = 50.5 bits (121), Expect = 4e-08
 Identities = 15/63 (23%), Positives = 33/63 (52%)

Query: 18 ERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPL 77
          + + F    R +R    L+Q+ +   +G  +S++  +E G+  +++ N++ LA  LD   
Sbjct: 6  DLVKFGQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEP 65

Query: 78 WKL 80
           +L
Sbjct: 66 REL 68


>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Length = 77 Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Length = 66 Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Length = 66 Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Length = 79 Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Length = 68 Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Length = 65 Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Length = 63 Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Length = 62 Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 89 Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Length = 87 Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Length = 67 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target83 transcriptional regulator [Candidatus Liberibacter asia
d1y7ya169 Restriction-modification controller protein C.AhdI {Aer 99.56
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [TaxId 99.56
d1y9qa179 Probable transcriptional regulator VC1968, N-terminal d 99.54
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subtilis [ 99.52
d1lmb3_87 lambda C1 repressor, DNA-binding domain {Bacteriophage 99.51
d2ofya182 Putative transcriptional regulator RHA1_ro04071 {Rhodoc 99.51
d1utxa_66 Putative transcription regulator CylR2 {Enterococcus fa 99.5
d2r1jl166 P22 C2 repressor, DNA-binding domain {Salmonella bacter 99.47
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas palustri 99.45
d1x57a178 Endothelial differentiation-related factor 1, EDF1 {Hum 99.42
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophage 434 99.4
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 99.4
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 99.38
d2icta187 Antitoxin HigA {Escherichia coli [TaxId: 562]} 99.35
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tumefaci 98.95
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nitrosom 98.63
d2bnma171 Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal 97.56
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 97.36
d1au7a272 Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.33
d1dwka186 Cyanase N-terminal domain {Escherichia coli [TaxId: 562 97.18
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherichia co 96.36
d2hsga157 Glucose-resistance amylase regulator CcpA, N-terminal d 96.35
d1ic8a294 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo s 95.98
d1qpza157 Purine repressor (PurR), N-terminal domain {Escherichia 95.98
d2awia165 PrgX {Enterococcus faecalis [TaxId: 1351]} 95.88
d1nera_74 Ner {Bacteriophage mu [TaxId: 10677]} 95.28
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Escherich 94.93
d1jhga_101 Trp repressor, TrpR {Escherichia coli [TaxId: 562]} 93.52
d2ox6a1162 Hypothetical protein SO3848 {Shewanella oneidensis [Tax 92.69
d1r71a_114 Transcriptional repressor protein KorB DNA-binding doma 91.62
d1s4ka_120 Putative cytoplasmic protein YdiL {Salmonella typhimuri 90.03
d1vz0a193 Putative partitioning protein ParB/Spo0J {Thermus therm 93.18
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium glutam 91.18
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: SinR domain-like
domain: Restriction-modification controller protein C.AhdI
species: Aeromonas hydrophila [TaxId: 644]
Probab=99.56  E-value=4.2e-15  Score=107.76  Aligned_cols=64  Identities=23%  Similarity=0.454  Sum_probs=61.3

Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHC
Q ss_conf             9999999999999983994999999863429999887558999448999999999289999960
Q gi|254781147|r   18 ERMIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLWKLL   81 (83)
Q Consensus        18 ~~~~~g~~ir~~R~~~gltq~ela~~~gis~~~is~iE~G~~~~~~~~l~~la~al~i~~~~l~   81 (83)
                      +-..||.+|+.+|+++||||+++|+.+|+|+++|++||+|+..|+++++.+||++||+++.+||
T Consensus         6 ~~~~~g~~ik~~R~~~gltq~~lA~~~gis~~~i~~~E~g~~~p~~~~l~~ia~~l~v~~~~lF   69 (69)
T d1y7ya1           6 DLVKFGQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPRELF   69 (69)
T ss_dssp             HHHHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTCSCCBHHHHHHHHHHTTSCGGGGC
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHC
T ss_conf             9999999999999983999999986829989899999879999999999999999695999979



>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2bnma1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dwka1 a.35.1.4 (A:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ic8a2 a.35.1.1 (A:87-180) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awia1 a.35.1.11 (A:2-66) PrgX {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nera_ a.35.1.2 (A:) Ner {Bacteriophage mu [TaxId: 10677]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ox6a1 a.35.1.6 (A:5-166) Hypothetical protein SO3848 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure