254781146

254781146

hypothetical protein CLIBASIA_05265

GeneID in NCBI database:8210171Locus tag:CLIBASIA_05265
Protein GI in NCBI database:254781146Protein Accession:YP_003065559.1
Gene range:-(1144047, 1144415)Protein Length:122aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSASS
ccccEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcc
cccccccHHHcccccHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
mspltllpirkkypcinrlshkeISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQIlprekikqdgitngdqltDEQLCEIIRSLEKELQIFTdfknkdahsretkettksass
mspltllpirkKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKnlreekpeqyLRLISqilprekikqdgitngdqlTDEQLCEIIRSLEKELQIftdfknkdahsretkettksass
MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSASS
**PLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIF**********************
MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKN*****************
**PLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNK****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSASS
MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSASS
MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSASS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target122 hypothetical protein CLIBASIA_05265 [Candidatus Liberib
315122537117 hypothetical protein CKC_03945 [Candidatus Liberibacter 1 4e-32
227821701125 hypothetical protein NGR_c11330 [Sinorhizobium fredii N 1 6e-08
150397046126 hypothetical protein Smed_1843 [Sinorhizobium medicae W 1 2e-07
15965773120 hypothetical protein SMc04191 [Sinorhizobium meliloti 1 1 5e-07
227822453151 hypothetical protein NGR_c19080 [Sinorhizobium fredii N 1 8e-07
13471715130 hypothetical protein mll1773 [Mesorhizobium loti MAFF30 1 1e-04
158422461220 putative bacteriophage protein [Azorhizobium caulinodan 1 2e-04
260463787131 conserved hypothetical protein [Mesorhizobium opportuni 1 7e-04
298292906106 bacteriophage protein [Starkeya novella DSM 506] Length 2 4e-06
14855732999 hypothetical protein Swit_4435 [Sphingomonas wittichii 2 8e-04
>gi|315122537|ref|YP_004063026.1| hypothetical protein CKC_03945 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 117 Back     alignment and organism information
 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/106 (66%), Positives = 87/106 (82%)

Query: 12  KYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIK 71
           KY   N+L H++ISLQ LY++VL  DFSK+GRKV+KNLR+EKPEQYLRLI+QILP+E IK
Sbjct: 12  KYSEKNQLFHQDISLQRLYKNVLIKDFSKHGRKVVKNLRKEKPEQYLRLIAQILPKENIK 71

Query: 72  QDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETT 117
           ++   NGD LTDEQLCEIIRSLEKELQ+ TD KN+D    + K+TT
Sbjct: 72  EEETINGDPLTDEQLCEIIRSLEKELQLVTDSKNQDVCPTKVKKTT 117


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821701|ref|YP_002825671.1| hypothetical protein NGR_c11330 [Sinorhizobium fredii NGR234] Length = 125 Back     alignment and organism information
>gi|150397046|ref|YP_001327513.1| hypothetical protein Smed_1843 [Sinorhizobium medicae WSM419] Length = 126 Back     alignment and organism information
>gi|15965773|ref|NP_386126.1| hypothetical protein SMc04191 [Sinorhizobium meliloti 1021] Length = 120 Back     alignment and organism information
>gi|227822453|ref|YP_002826425.1| hypothetical protein NGR_c19080 [Sinorhizobium fredii NGR234] Length = 151 Back     alignment and organism information
>gi|13471715|ref|NP_103282.1| hypothetical protein mll1773 [Mesorhizobium loti MAFF303099] Length = 130 Back     alignment and organism information
>gi|158422461|ref|YP_001523753.1| putative bacteriophage protein [Azorhizobium caulinodans ORS 571] Length = 220 Back     alignment and organism information
>gi|260463787|ref|ZP_05811984.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] Length = 131 Back     alignment and organism information
>gi|298292906|ref|YP_003694845.1| bacteriophage protein [Starkeya novella DSM 506] Length = 106 Back     alignment and organism information
>gi|148557329|ref|YP_001264911.1| hypothetical protein Swit_4435 [Sphingomonas wittichii RW1] Length = 99 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00