254781148

254781148

hypothetical protein CLIBASIA_05275

GeneID in NCBI database:8210173Locus tag:CLIBASIA_05275
Protein GI in NCBI database:254781148Protein Accession:YP_003065561.1
Gene range:+(1146986, 1147195)Protein Length:69aa
Gene description:hypothetical protein
COG prediction:[L] Replicative DNA helicase
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------7
MLSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRKTTNEC
cccHHHHHHHcccccEEEEEEEcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccccHHHHccccccHEHHHHHHHHHHHHHHHHccccHHHHHHcHHHcccccHHHHHHHHHHcccccc
mlsdfskkyysrnnnsIYYFIGLEQEILGSLLlkgnlqpiisfldaqhfidpIHSEVFRAITRKTTNEC
mlsdfskkYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRKTTNEC
MLSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRKTTNEC
********YYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRK*****
MLSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRKTTNEC
**SDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRKT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRKTTNEC
MLSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRKTTNEC
MLSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITRKTTNEC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target69 hypothetical protein CLIBASIA_05275 [Candidatus Liberib
315122540 475 replicative DNA helicase [Candidatus Liberibacter solan 1 3e-07
>gi|315122540|ref|YP_004063029.1| replicative DNA helicase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 475 Back     alignment and organism information
 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%)

Query: 19 YFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAI 61
          +F+  EQEILGSLLL GNL+PIISFLDA+HFIDP+HSE+FRAI
Sbjct: 8  FFVEFEQEILGSLLLNGNLKPIISFLDAKHFIDPVHSEIFRAI 50


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target69 hypothetical protein CLIBASIA_05275 [Candidatus Liberib
TIGR03600 421 TIGR03600, phage_DnaB, phage replicative helicase, DnaB 3e-04
TIGR00665 434 TIGR00665, DnaB, replicative DNA helicase 0.003
pfam00772103 pfam00772, DnaB, DnaB-like helicase N terminal domain 0.001
>gnl|CDD|132639 TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>gnl|CDD|161985 TIGR00665, DnaB, replicative DNA helicase Back     alignment and domain information
>gnl|CDD|144390 pfam00772, DnaB, DnaB-like helicase N terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 69 hypothetical protein CLIBASIA_05275 [Candidatus Liberib
PRK05636 507 replicative DNA helicase; Provisional 96.26
PRK08082 453 consensus 96.08
PRK07773 868 replicative DNA helicase; Validated 96.05
PRK08760 476 replicative DNA helicase; Provisional 95.97
PRK05748 448 replicative DNA helicase; Provisional 95.96
PRK06904 472 replicative DNA helicase; Validated 95.93
PRK07263 453 consensus 95.84
TIGR03600 421 phage_DnaB phage replicative helicase, DnaB family, HK0 95.83
PRK08006 471 replicative DNA helicase; Provisional 95.74
PRK08840 464 replicative DNA helicase; Provisional 95.71
PRK08694 468 consensus 95.69
PRK09165 484 replicative DNA helicase; Provisional 95.62
pfam00772103 DnaB DnaB-like helicase N terminal domain. The hexameri 95.53
PRK07004 460 replicative DNA helicase; Provisional 95.47
PRK06321 472 replicative DNA helicase; Provisional 95.45
PRK06749 428 replicative DNA helicase; Provisional 95.27
PRK08506 473 replicative DNA helicase; Provisional 95.23
PRK05595 444 replicative DNA helicase; Provisional 94.85
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08082 consensus Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK07263 consensus Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08694 consensus Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>pfam00772 DnaB DnaB-like helicase N terminal domain Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target69 hypothetical protein CLIBASIA_05275 [Candidatus Liberib
2r6a_A 454 DNAB helicase, replicative helicase; replication, DNAB; 9e-05
3bgw_A 444 DNAB-like replicative helicase; ATPase, replication; 3. 0.002
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Length = 454 Back     alignment and structure
 Score = 40.6 bits (94), Expect = 9e-05
 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%)

Query: 21 IGLEQEILGSLLL-KGNLQPIISFLDAQHFIDPIHSEVFRAITR 63
          I  EQ +LG++ L    L P    L  + F    H ++F A+ R
Sbjct: 14 IEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLR 57


>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Length = 444 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target69 hypothetical protein CLIBASIA_05275 [Candidatus Liberib
1b79_A119 DNAB helicase; hexamer, DNA replication, hydrolase; 2.3 96.18
3gxv_A123 Replicative DNA helicase; hexameric helicase, primase, 95.51
2r6a_A 454 DNAB helicase, replicative helicase; replication, DNAB; 95.02
3bgw_A 444 DNAB-like replicative helicase; ATPase, replication; 3. 94.62
2r5u_A 200 Replicative DNA helicase; DNAB, primase, replication, A 94.42
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A {Therm 94.08
>1b79_A DNAB helicase; hexamer, DNA replication, hydrolase; 2.30A {Escherichia coli} SCOP: a.81.1.1 PDB: 1jwe_A Back     alignment and structure
Probab=96.18  E-value=0.0031  Score=37.59  Aligned_cols=45  Identities=27%  Similarity=0.417  Sum_probs=38.3

Q ss_pred             EECHHHHHHHHHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7100899988887065559-99985177621147899999985522
Q gi|254781148|r   21 IGLEQEILGSLLLKGNLQP-IISFLDAQHFIDPIHSEVFRAITRKT   65 (69)
Q Consensus        21 igleqeilgslllkgnlqp-iisfldaqhfidpihsevfraitrkt   65 (69)
                      +-.||.+||++|+..+.-. +..+|.+.+|-+|.|..+|++|..-.
T Consensus        21 ~eAE~~vLG~lL~~p~~~~~v~~~l~~edFy~~~h~~If~ai~~l~   66 (119)
T 1b79_A           21 IEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQ   66 (119)
T ss_dssp             HHHHHHHHHHHHHCGGGHHHHHTTCCGGGSSSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHCCCHHHCCCHHHHHHHHHHHHHH
T ss_conf             8999999999991851899999604998718898999999999998



>3gxv_A Replicative DNA helicase; hexameric helicase, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication; 2.20A {Helicobacter pylori} PDB: 3gxv_D 3gxv_C Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2r5u_A Replicative DNA helicase; DNAB, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication, DNA-binding, endonuclease; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target69 hypothetical protein CLIBASIA_05275 [Candidatus Liberib
d1b79a_102 N-terminal domain of DnaB helicase {Escherichia coli [T 95.97
>d1b79a_ a.81.1.1 (A:) N-terminal domain of DnaB helicase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: N-terminal domain of DnaB helicase
superfamily: N-terminal domain of DnaB helicase
family: N-terminal domain of DnaB helicase
domain: N-terminal domain of DnaB helicase
species: Escherichia coli [TaxId: 562]
Probab=95.97  E-value=0.0027  Score=36.70  Aligned_cols=44  Identities=27%  Similarity=0.453  Sum_probs=37.6

Q ss_pred             EECHHHHHHHHHHHCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             71008999888870655-599998517762114789999998552
Q gi|254781148|r   21 IGLEQEILGSLLLKGNL-QPIISFLDAQHFIDPIHSEVFRAITRK   64 (69)
Q Consensus        21 igleqeilgslllkgnl-qpiisfldaqhfidpihsevfraitrk   64 (69)
                      +-.||.+||++|+.++. .-+..++...+|-+|.|..+|++|..-
T Consensus         5 ~eaE~~vLg~lL~~~~~~~~v~~~l~~~dFy~~~h~~If~ai~~l   49 (102)
T d1b79a_           5 IEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARL   49 (102)
T ss_dssp             HHHHHHHHHHHHHCGGGHHHHHTTCCGGGSSSHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHCCHHHHCHHHHHHHHHHHHHH
T ss_conf             899999999999391389999975399986519899999999998



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 69 hypothetical protein CLIBASIA_05275 [Candidatus Li
3gxv_A_123 (A:) Replicative DNA helicase; hexameric helicase, 0.002
2r5u_A_ 200 (A:) Replicative DNA helicase; DNAB, primase, repl 0.003
2r6a_A_1-155155 (A:1-155) DNAB helicase, replicative helicase; rep 0.004
>3gxv_A (A:) Replicative DNA helicase; hexameric helicase, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication; 2.20A {Helicobacter pylori} PDB: 3gxv_D 3gxv_CLength = 123 Back     alignment and structure
 Score = 36.0 bits (83), Expect = 0.002
 Identities = 8/44 (18%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query: 21 IGLEQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVFRAITR 63
            +E+ +L  ++L  + ++ + S L+   F  P +   F    +
Sbjct: 11 QNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALK 54


>2r5u_A (A:) Replicative DNA helicase; DNAB, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication, DNA-binding, endonuclease; 1.90A {Mycobacterium tuberculosis}Length = 200 Back     alignment and structure
>2r6a_A (A:1-155) DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_ALength = 155 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target69 hypothetical protein CLIBASIA_05275 [Candidatus Liberib
3gxv_A_123 Replicative DNA helicase; hexameric helicase, prim 95.33
2r6a_A_1-155155 DNAB helicase, replicative helicase; replication, 95.08
2q6t_A_1-152152 DNAB replication FORK helicase; hydrolase; 2.90A { 94.94
2r5u_A_ 200 Replicative DNA helicase; DNAB, primase, replicati 94.25
1b79_A_119 DNAB helicase; hexamer, DNA replication; 2.30A {Es 93.6
3bgw_A_1-154154 DNAB-like replicative helicase; ATPase, replicatio 92.97
>3gxv_A (A:) Replicative DNA helicase; hexameric helicase, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication; 2.20A {Helicobacter pylori} PDB: 3gxv_D 3gxv_C Back     alignment and structure
Probab=95.33  E-value=0.016  Score=34.61  Aligned_cols=44  Identities=18%  Similarity=0.306  Sum_probs=37.6

Q ss_pred             EECHHHHHHHHHHHCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             710089998888706555-99998517762114789999998552
Q gi|254781148|r   21 IGLEQEILGSLLLKGNLQ-PIISFLDAQHFIDPIHSEVFRAITRK   64 (69)
Q Consensus        21 igleqeilgslllkgnlq-piisfldaqhfidpihsevfraitrk   64 (69)
                      +..||.+||++|..++.- -+...|...+|-+|.|..+|++|..-
T Consensus        11 ~~aE~~lLg~ll~~~~~~~~v~~~L~~edF~~~~h~~If~~i~~l   55 (123)
T 3gxv_A           11 QNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALKL   55 (123)
T ss_dssp             HHHHHHHHHHHHHSGGGHHHHHTTCCGGGCSSHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHCCHHHHCCHHHHHHHHHHHHH
T ss_conf             999999999999697289999966899982989899999999999



>2r6a_A (A:1-155) DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2q6t_A (A:1-152) DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r5u_A (A:) Replicative DNA helicase; DNAB, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication, DNA-binding, endonuclease; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1b79_A (A:) DNAB helicase; hexamer, DNA replication; 2.30A {Escherichia coli} Back     alignment and structure
>3bgw_A (A:1-154) DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure