254781149

254781149

replicative DNA helicase

GeneID in NCBI database:8210174Locus tag:CLIBASIA_05280
Protein GI in NCBI database:254781149Protein Accession:YP_003065562.1
Gene range:+(1147185, 1147985)Protein Length:266aa
Gene description:replicative DNA helicase
COG prediction:[L] Replicative DNA helicase
KEGG prediction:replicative DNA helicase
SEED prediction:DnaB helicase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MNAEIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHTKMVQLYRLLS
ccHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHcccccccccHHHHHcccccHHHHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHHcHHHHHHHHcc
ccHHHHHHcccHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHcHHcHccccccHHHEccccccHHHHHHHHHHHHHHHHcccEEcccccccHHHHHHHHHHHHHHccccEEHHEHcc
MNAEIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALalhtsdptcntATLIRKSMQSFEDIISEVHltknqctgsscISIANAATTAMKSAEQqkkegenpdikwglQSVDHLMGGVQLRELILIgarpsmgktTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSnllypsssripylnlirgEINQEQYRISQGICeklqdfpliiddrpspgimEFVHVANGLRNKHTKMVQLYRLLS
mnaeiishFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKalalhtsdptCNTATLIRKSMQSFEDIISEVHltknqctgSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALsnllypsssRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHvanglrnkhtkmvqlyrlls
MNAEIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHTKMVQLYRLLS
**AEII********ISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDI********************NAATTAMKSA*********PDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLY*****I***NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHTKMVQLYRLLS
MNAEIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDIISEVHLTKNQCTGSSCISIANAAT**************NPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHTKMVQLYRLLS
*NAEIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHTKMVQLYRLLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAEIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHTKMVQLYRLLS
MNAEIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHTKMVQLYRLLS
MNAEIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHTKMVQLYRLLS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target266 replicative DNA helicase [Candidatus Liberibacter asiat
254780332 504 replicative DNA helicase [Candidatus Liberibacter 6e-16
254780334 479 DNA repair protein RadA [Candidatus Liberibacter a 9e-04
>gi|254780332|ref|YP_003064745.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 504 Back     alignment 
 Score = 75.9 bits (185), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 79/163 (48%), Gaps = 21/163 (12%)

Query: 88  HLTKNQCTGSSCISIANAATTAMKSAEQQ-KKEGENPDIKWGLQSVDHLMGGVQLRELIL 146
           HL +N        + ++A T A+  A Q   ++G    +  G+Q++D  MGG+Q  +LI+
Sbjct: 164 HLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLII 223

Query: 147 IGARPSMGKTTFALSTALHMA---------------MSGHGVAFFSLEMDREKLGARALS 191
           I  RP MGKT+ A + A ++A               ++G  V F+SLEM  E+L  R +S
Sbjct: 224 IAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIIS 283

Query: 192 NLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIID 234
                  + +P   + RGE+ +  Y       + +Q  PL ID
Sbjct: 284 E-----QTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYID 321
>gi|254780334|ref|YP_003064747.1| DNA repair protein RadA [Candidatus Liberibacter asiaticus str. psy62] Length = 479 Back     alignment 
 Score = 35.4 bits (80), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 129 LQSVDHLMGGVQLR-ELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE 179
           +  +D + GG  +R  +IL+G  P +GK+T  + TA  +A   H + + S E
Sbjct: 76  IDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGE 127

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target266 replicative DNA helicase [Candidatus Liberibacter asiat
315122540 475 replicative DNA helicase [Candidatus Liberibacter solan 1 1e-109
292669342 440 DNA replication protein DnaC [Selenomonas noxia ATCC 43 1 2e-15
304437861 439 replicative DNA helicase DnaB [Selenomonas sp. oral tax 1 2e-15
238926663 448 DNA replication protein DnaC [Selenomonas flueggei ATCC 1 3e-15
260888718 441 replicative DNA helicase [Selenomonas sputigena ATCC 35 1 7e-15
268315593 945 replicative DNA helicase [Rhodothermus marinus DSM 4252 1 8e-15
313897021 440 replicative DNA helicase [Selenomonas sp. oral taxon 13 1 8e-15
320531030 440 replicative DNA helicase [Selenomonas artemidis F0399] 1 9e-15
298372503 521 replicative DNA helicase [Bacteroidetes oral taxon 274 1 2e-14
317123151 443 primary replicative DNA helicase [Thermaerobacter maria 1 3e-14
>gi|315122540|ref|YP_004063029.1| replicative DNA helicase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 475 Back     alignment and organism information
 Score =  397 bits (1021), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/243 (77%), Positives = 217/243 (89%)

Query: 1   MNAEIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALAL 60
           MN+EIISHFE QTKI+FSTYL NLLTLA++ISSEVINAARRVVQQWARITISQEAK L+L
Sbjct: 69  MNSEIISHFEKQTKITFSTYLGNLLTLATTISSEVINAARRVVQQWARITISQEAKTLSL 128

Query: 61  HTSDPTCNTATLIRKSMQSFEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEG 120
           +TS P+CNT +LI+K MQ+FEDI SE+ L  N+CT +SCISIA+AA TAM SAEQQK++ 
Sbjct: 129 YTSHPSCNTTSLIQKFMQNFEDINSEIRLANNKCTSTSCISIAHAAKTAMISAEQQKEKD 188

Query: 121 ENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEM 180
            N D+KWGL+S+DHL+GGVQLRELILIGARPSMGKTTFALS AL M MSGHGVAFFSLEM
Sbjct: 189 GNTDLKWGLKSIDHLIGGVQLRELILIGARPSMGKTTFALSVALQMTMSGHGVAFFSLEM 248

Query: 181 DREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPG 240
           DREK+GARALSNLLY S +RIPY+NLIRGEINQEQ+R S+ ICE+LQ+FPLIIDDR  P 
Sbjct: 249 DREKIGARALSNLLYESPARIPYINLIRGEINQEQHRSSKEICEQLQNFPLIIDDRTFPT 308

Query: 241 IME 243
           I+E
Sbjct: 309 IVE 311



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|292669342|ref|ZP_06602768.1| DNA replication protein DnaC [Selenomonas noxia ATCC 43541] Length = 440 Back     alignment and organism information
>gi|304437861|ref|ZP_07397809.1| replicative DNA helicase DnaB [Selenomonas sp. oral taxon 149 str. 67H29BP] Length = 439 Back     alignment and organism information
>gi|238926663|ref|ZP_04658423.1| DNA replication protein DnaC [Selenomonas flueggei ATCC 43531] Length = 448 Back     alignment and organism information
>gi|260888718|ref|ZP_05899981.1| replicative DNA helicase [Selenomonas sputigena ATCC 35185] Length = 441 Back     alignment and organism information
>gi|268315593|ref|YP_003289312.1| replicative DNA helicase [Rhodothermus marinus DSM 4252] Length = 945 Back     alignment and organism information
>gi|313897021|ref|ZP_07830568.1| replicative DNA helicase [Selenomonas sp. oral taxon 137 str. F0430] Length = 440 Back     alignment and organism information
>gi|320531030|ref|ZP_08032060.1| replicative DNA helicase [Selenomonas artemidis F0399] Length = 440 Back     alignment and organism information
>gi|298372503|ref|ZP_06982493.1| replicative DNA helicase [Bacteroidetes oral taxon 274 str. F0058] Length = 521 Back     alignment and organism information
>gi|317123151|ref|YP_004103154.1| primary replicative DNA helicase [Thermaerobacter marianensis DSM 12885] Length = 443 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target266 replicative DNA helicase [Candidatus Liberibacter asiat
TIGR00665 434 TIGR00665, DnaB, replicative DNA helicase 9e-28
PRK09165 497 PRK09165, PRK09165, replicative DNA helicase; Provision 3e-20
COG0305 435 COG0305, DnaB, Replicative DNA helicase [DNA replicatio 8e-22
cd00984 242 cd00984, DnaB_C, DnaB helicase C terminal domain 2e-21
pfam03796186 pfam03796, DnaB_C, DnaB-like helicase C terminal domain 5e-21
PRK07773 886 PRK07773, PRK07773, replicative DNA helicase; Validated 3e-18
PRK06749 428 PRK06749, PRK06749, replicative DNA helicase; Provision 5e-15
PRK08760 476 PRK08760, PRK08760, replicative DNA helicase; Provision 3e-14
PRK05595 444 PRK05595, PRK05595, replicative DNA helicase; Provision 3e-13
PRK05748 448 PRK05748, PRK05748, replicative DNA helicase; Provision 3e-12
PRK07004 460 PRK07004, PRK07004, replicative DNA helicase; Provision 2e-10
PRK08006 471 PRK08006, PRK08006, replicative DNA helicase; Provision 4e-10
PRK08840 464 PRK08840, PRK08840, replicative DNA helicase; Provision 3e-09
PRK06904 472 PRK06904, PRK06904, replicative DNA helicase; Validated 8e-09
PRK05636 505 PRK05636, PRK05636, replicative DNA helicase; Provision 2e-08
PRK06321 472 PRK06321, PRK06321, replicative DNA helicase; Provision 4e-07
TIGR03600 421 TIGR03600, phage_DnaB, phage replicative helicase, DnaB 1e-20
PRK08506 472 PRK08506, PRK08506, replicative DNA helicase; Provision 1e-18
COG1066 456 COG1066, Sms, Predicted ATP-dependent serine protease [ 0.001
PRK05973237 PRK05973, PRK05973, replicative DNA helicase; Provision 2e-06
cd01122 271 cd01122, GP4d_helicase, GP4d_helicase is a homohexameri 5e-04
COG0467 260 COG0467, RAD55, RecA-superfamily ATPases implicated in 5e-04
cd01121 372 cd01121, Sms, Sms (bacterial radA) DNA repair protein 0.002
PHA02542 473 PHA02542, 41, 41 helicase; Provisional 0.004
COG0468279 COG0468, RecA, RecA/RadA recombinase [DNA replication, 0.002
>gnl|CDD|161985 TIGR00665, DnaB, replicative DNA helicase Back     alignment and domain information
>gnl|CDD|181676 PRK09165, PRK09165, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|30653 COG0305, DnaB, Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|29985 cd00984, DnaB_C, DnaB helicase C terminal domain Back     alignment and domain information
>gnl|CDD|146436 pfam03796, DnaB_C, DnaB-like helicase C terminal domain Back     alignment and domain information
>gnl|CDD|181111 PRK07773, PRK07773, replicative DNA helicase; Validated Back     alignment and domain information
>gnl|CDD|168658 PRK06749, PRK06749, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|181547 PRK08760, PRK08760, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|180157 PRK05595, PRK05595, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|180232 PRK05748, PRK05748, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|180791 PRK07004, PRK07004, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|181193 PRK08006, PRK08006, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|181562 PRK08840, PRK08840, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|136106 PRK06904, PRK06904, replicative DNA helicase; Validated Back     alignment and domain information
>gnl|CDD|180177 PRK05636, PRK05636, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|180528 PRK06321, PRK06321, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|132639 TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>gnl|CDD|181451 PRK08506, PRK08506, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|31265 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|168322 PRK05973, PRK05973, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|29988 cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>gnl|CDD|30815 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|29987 cd01121, Sms, Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>gnl|CDD|177377 PHA02542, 41, 41 helicase; Provisional Back     alignment and domain information
>gnl|CDD|30816 COG0468, RecA, RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 266 replicative DNA helicase [Candidatus Liberibacter asiat
PRK07773 868 replicative DNA helicase; Validated 100.0
PRK09165 484 replicative DNA helicase; Provisional 100.0
PRK07004 460 replicative DNA helicase; Provisional 100.0
PRK05636 507 replicative DNA helicase; Provisional 100.0
PRK08506 473 replicative DNA helicase; Provisional 100.0
PRK08760 476 replicative DNA helicase; Provisional 100.0
PRK08694 468 consensus 100.0
PRK06321 472 replicative DNA helicase; Provisional 100.0
PRK08082 453 consensus 100.0
PRK05595 444 replicative DNA helicase; Provisional 100.0
PRK07263 453 consensus 100.0
PRK05748 448 replicative DNA helicase; Provisional 100.0
PRK08840 464 replicative DNA helicase; Provisional 100.0
PRK06904 472 replicative DNA helicase; Validated 100.0
PRK08006 471 replicative DNA helicase; Provisional 100.0
COG0305 435 DnaB Replicative DNA helicase [DNA replication, recombi 100.0
TIGR03600 421 phage_DnaB phage replicative helicase, DnaB family, HK0 100.0
PRK06749 428 replicative DNA helicase; Provisional 100.0
TIGR00665 465 DnaB replicative DNA helicase; InterPro: IPR007692 This 100.0
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 96.22
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 99.98
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexameric h 99.96
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 99.94
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This prote 99.48
PRK11823 454 DNA repair protein RadA; Provisional 99.42
PRK09302 501 circadian clock protein KaiC; Reviewed 99.37
TIGR00416 481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 99.28
COG1066 456 Sms Predicted ATP-dependent serine protease [Posttransl 99.28
KOG2373 514 consensus 98.82
pfam00154 322 RecA recA bacterial DNA recombination protein. RecA is 98.56
cd00983 325 recA RecA is a bacterial enzyme which has roles in homo 98.52
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 98.43
PRK09354 350 recA recombinase A; Provisional 98.33
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 98.32
PRK04301318 radA DNA repair and recombination protein RadA; Validat 98.28
PTZ00035350 Rad51; Provisional 98.03
PRK09519 790 recA recombinase A; Reviewed 97.88
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 97.71
PRK06526254 transposase; Provisional 97.61
PRK08116262 hypothetical protein; Validated 97.19
PRK08181269 transposase; Validated 97.08
PRK06921265 hypothetical protein; Provisional 97.0
TIGR02655484 circ_KaiC circadian clock protein KaiC; InterPro: IPR01 96.89
PRK07952242 DNA replication protein DnaC; Validated 96.76
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 96.62
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.56
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.54
PRK10865 857 protein disaggregation chaperone; Provisional 96.54
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 96.54
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.45
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.44
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 96.28
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 96.27
TIGR02012 322 tigrfam_recA protein RecA; InterPro: IPR001553 The recA 96.25
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.24
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.21
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.2
cd03246173 ABCC_Protease_Secretion This family represents the ABC 96.16
PRK06995 404 flhF flagellar biosynthesis regulator FlhF; Validated 96.02
PRK06835330 DNA replication protein DnaC; Validated 95.97
PRK07471 363 DNA polymerase III subunit delta'; Validated 95.97
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 95.91
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 95.86
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.85
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 95.81
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 95.8
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.77
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 95.74
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.65
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 95.65
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 95.6
PRK08939306 primosomal protein DnaI; Reviewed 95.53
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 95.44
PRK03846198 adenylylsulfate kinase; Provisional 95.4
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.37
COG2401593 ABC-type ATPase fused to a predicted acetyltransferase 95.36
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 95.35
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.34
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 95.33
COG4987573 CydC ABC-type transport system involved in cytochrome b 95.32
CHL00095 823 clpC Clp protease ATP binding subunit 95.32
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 95.31
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.29
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 95.26
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 95.25
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 95.25
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.25
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.22
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 95.22
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 95.22
KOG1434335 consensus 95.21
PRK13549513 xylose transporter ATP-binding subunit; Provisional 95.21
pfam03266168 DUF265 Protein of unknown function, DUF265. 95.19
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.19
PRK00440 318 rfc replication factor C small subunit; Reviewed 95.15
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.14
TIGR02655 484 circ_KaiC circadian clock protein KaiC; InterPro: IPR01 95.11
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 95.11
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.11
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.1
PRK05541176 adenylylsulfate kinase; Provisional 95.09
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.08
PRK08084235 DNA replication initiation factor; Provisional 95.04
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 95.03
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 95.02
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 95.01
PRK10522547 multidrug transporter membrane component/ATP-binding co 94.99
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.97
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 94.93
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.93
PRK04195 403 replication factor C large subunit; Provisional 94.93
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.92
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Provisi 94.9
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.9
PRK00889175 adenylylsulfate kinase; Provisional 94.89
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 94.85
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 94.84
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 94.8
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 94.78
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 94.76
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.75
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 94.74
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 94.73
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.69
PRK10908222 cell division protein FtsE; Provisional 94.67
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 94.66
PRK06893229 DNA replication initiation factor; Validated 94.63
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.61
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.56
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 94.55
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 94.52
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 94.49
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 94.46
PRK10744257 phosphate transporter subunit; Provisional 94.44
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 94.43
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 94.39
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 94.38
cd03234226 ABCG_White The White subfamily represents ABC transport 94.35
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 94.33
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 94.33
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 94.32
KOG0061 613 consensus 94.3
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 94.29
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.28
PRK08727233 hypothetical protein; Validated 94.27
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 94.17
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 94.14
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 94.11
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 94.1
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 94.09
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 94.08
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 94.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 94.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 93.99
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 93.98
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 93.96
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 93.84
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 93.82
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 93.78
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 93.71
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 93.69
PRK09984262 phosphonate/organophosphate ester transporter subunit; 93.68
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 93.66
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 93.6
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.59
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 93.59
COG4608 268 AppF ABC-type oligopeptide transport system, ATPase com 93.58
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 93.56
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 93.54
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 93.5
PRK09473 330 oppD oligopeptide transporter ATP-binding component; Pr 93.48
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.44
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 93.44
PRK09700510 D-allose transporter ATP-binding protein; Provisional 93.41
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 93.39
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 93.38
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 93.31
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 93.23
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 93.23
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.16
PRK13542224 consensus 93.15
PRK11153 343 metN DL-methionine transporter ATP-binding subunit; Pro 93.12
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 93.12
COG4133209 CcmA ABC-type transport system involved in cytochrome c 93.11
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 93.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 92.97
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 92.97
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 92.95
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 92.92
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 92.91
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 92.9
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 92.9
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 92.88
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 92.88
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 92.85
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 92.84
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 92.82
PRK10762501 D-ribose transporter ATP binding protein; Provisional 92.79
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 92.79
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 92.77
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 92.76
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 92.75
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 92.75
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 92.74
PRK11022 327 dppD dipeptide transporter ATP-binding subunit; Provisi 92.65
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 92.64
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 92.56
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 92.53
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 92.5
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 92.5
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 92.49
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 92.46
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 92.41
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 92.4
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 92.32
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 92.3
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 92.19
KOG0057591 consensus 92.15
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 92.14
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 91.99
cd03114148 ArgK-like The function of this protein family is unkown 91.98
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 91.92
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 91.91
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 91.9
PRK10789569 putative multidrug transporter membrane\ATP-binding com 91.84
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 91.76
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 91.68
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 91.63
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 91.61
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 91.61
TIGR02928 383 TIGR02928 orc1/cdc6 family replication initiation prote 91.56
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 91.49
PRK13544208 consensus 91.44
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 91.44
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 91.38
PRK11147 632 ABC transporter ATPase component; Reviewed 91.28
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 91.22
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 90.96
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 90.88
PRK13409590 putative ATPase RIL; Provisional 90.72
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 90.69
TIGR01968 272 minD_bact septum site-determining protein MinD; InterPr 90.39
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 90.2
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 90.15
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 90.1
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 90.09
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 90.01
PRK05973237 replicative DNA helicase; Provisional 99.88
pfam06745231 KaiC KaiC. This family represents a conserved region wi 99.37
PRK04328 250 hypothetical protein; Provisional 99.35
PRK06067241 flagellar accessory protein FlaH; Validated 99.33
PRK09302 501 circadian clock protein KaiC; Reviewed 99.3
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 99.26
cd01394218 radB RadB. The archaeal protein radB shares similarity 99.23
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signal tra 99.11
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 98.96
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.9
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 98.76
cd01124187 KaiC KaiC is a circadian clock protein primarily found 98.59
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 98.29
cd01125 239 repA Hexameric Replicative Helicase RepA. RepA is encod 97.97
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 97.87
PRK09183258 transposase/IS protein; Provisional 97.23
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.2
PRK12377248 putative replication protein; Provisional 97.14
pfam09140 261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 97.11
pfam06068 395 TIP49 TIP49 C-terminus. This family consists of the C-t 97.1
KOG1433326 consensus 97.04
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 97.04
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 96.97
PRK13764 605 ATPase; Provisional 96.86
smart00382148 AAA ATPases associated with a variety of cellular activ 96.83
COG3598 402 RepA RecA-family ATPase [DNA replication, recombination 96.81
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 96.75
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 96.71
COG1855 604 ATPase (PilT family) [General function prediction only] 96.66
PRK06696227 uridine kinase; Validated 96.65
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 96.52
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 96.39
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 96.36
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 96.32
CHL00060 480 atpB ATP synthase CF1 beta subunit 96.28
PRK11519720 tyrosine kinase; Provisional 96.25
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.25
COG1484254 DnaC DNA replication protein [DNA replication, recombin 96.19
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 96.19
KOG2680 454 consensus 96.18
PRK12597 459 F0F1 ATP synthase subunit beta; Provisional 95.94
PRK09280 466 F0F1 ATP synthase subunit beta; Validated 95.88
cd02040 270 NifH NifH gene encodes component II (iron protein) of n 95.74
PRK07667190 uridine kinase; Provisional 95.72
TIGR03305 449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 95.7
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 95.7
TIGR00345 330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 95.56
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 95.55
cd02036179 MinD Bacterial cell division requires the formation of 95.51
pfam00142 269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 95.51
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 95.46
CHL00175 279 minD septum-site determining protein; Validated 95.46
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 95.46
KOG1564 351 consensus 95.44
PRK00411 394 cdc6 cell division control protein 6; Reviewed 95.35
PRK10818270 cell division inhibitor MinD; Provisional 95.31
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 95.31
cd02034116 CooC The accessory protein CooC, which contains a nucle 95.31
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 95.29
pfam06564 244 YhjQ YhjQ protein. This family consists of several bact 95.12
PRK11784333 tRNA 2-selenouridine synthase; Provisional 95.02
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 95.01
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 94.95
PRK13695174 putative NTPase; Provisional 94.93
PRK09112 352 DNA polymerase III subunit delta'; Validated 94.88
PRK09270230 frcK putative fructose transport system kinase; Reviewe 94.85
PRK06851368 hypothetical protein; Provisional 94.84
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 94.81
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 94.78
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 94.69
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 94.67
COG2894 272 MinD Septum formation inhibitor-activating ATPase [Cell 94.67
cd03111106 CpaE_like This protein family consists of proteins simi 94.61
PHA02518211 ParA-like protein; Provisional 94.57
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central domain. 94.54
PRK06315 442 type III secretion system ATPase; Provisional 94.47
PRK10490 895 sensor protein KdpD; Provisional 94.39
pfam02702211 KdpD Osmosensitive K+ channel His kinase sensor domain. 94.38
PRK08903227 hypothetical protein; Validated 94.33
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 94.32
cd02117212 NifH_like This family contains the NifH (iron protein) 94.29
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 94.26
PRK13869 405 plasmid-partitioning protein RepA; Provisional 94.25
PRK10037 250 cell division protein; Provisional 94.17
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 94.12
PRK05642234 DNA replication initiation factor; Validated 94.06
CHL00059 501 atpA ATP synthase CF1 alpha subunit 94.01
TIGR00750 333 lao LAO/AO transport system ATPase; InterPro: IPR005129 93.92
PRK08927 441 fliI flagellum-specific ATP synthase; Validated 93.84
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 93.81
PHA02519 387 plasmid partition protein SopA; Reviewed 93.77
PRK13705 388 plasmid-partitioning protein SopA; Provisional 93.7
TIGR03324 497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha. 93.65
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subu 93.55
TIGR03453 387 partition_RepA plasmid partitioning protein RepA. Membe 93.54
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 93.5
PRK11670 369 putative ATPase; Provisional 93.42
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 93.42
TIGR02640 265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 93.4
pfam03308 267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 92.89
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, an A 92.81
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 92.68
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 92.59
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. Membe 92.48
PRK13849 231 putative crown gall tumor protein VirC1; Provisional 92.21
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-specific 92.15
PRK09435 325 arginine/ornithine transport system ATPase; Provisional 92.12
KOG1942 456 consensus 92.08
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 92.04
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 92.03
cd02032267 Bchl_like This family of proteins contains bchL and chl 91.95
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 91.95
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 91.73
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 91.71
PRK07721 435 fliI flagellum-specific ATP synthase; Validated 91.65
pfam07088484 GvpD GvpD gas vesicle protein. This family consists of 91.64
PRK08149 427 ATP synthase SpaL; Validated 91.13
KOG0065 1391 consensus 91.03
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. Membe 90.99
PRK09099 441 type III secretion system ATPase; Provisional 90.47
PRK06936 439 type III secretion system ATPase; Provisional 90.43
TIGR01587 424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 90.43
KOG3022 300 consensus 90.3
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 90.26
smart00487201 DEXDc DEAD-like helicases superfamily. 90.24
PRK04196 460 V-type ATP synthase subunit B; Provisional 90.21
PRK08472 435 fliI flagellum-specific ATP synthase; Validated 90.18
pfam07726131 AAA_3 ATPase family associated with various cellular ac 90.08
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 90.08
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 90.07
TIGR01005778 eps_transp_fam exopolysaccharide transport protein fami 90.07
PRK05480209 uridine kinase; Provisional 90.01
PRK09401 1176 reverse gyrase; Reviewed 96.87
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 96.39
COG4604252 CeuD ABC-type enterochelin transport system, ATPase com 94.99
TIGR02546 430 III_secr_ATP type III secretion apparatus H+-transporti 94.66
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 94.46
KOG1806 1320 consensus 93.89
TIGR00635 305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 92.16
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 91.63
TIGR02746 900 TraC-F-type type-IV secretion system protein TraC; Inte 90.08
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 96.72
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 95.84
PRK13636 285 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.3
PRK13651 304 cobalt transporter ATP-binding subunit; Provisional 95.3
PRK13768253 GTPase; Provisional 93.53
PRK07594 433 type III secretion system ATPase; Validated 91.94
PRK05922 434 type III secretion system ATPase; Validated 91.47
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. Membe 90.77
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 96.2
PRK04040189 adenylate kinase; Provisional 94.79
pfam00931285 NB-ARC NB-ARC domain. 92.52
KOG2825323 consensus 92.32
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 92.15
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 91.65
PRK00090223 bioD dithiobiotin synthetase; Reviewed 91.47
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 91.37
PRK13233275 nifH nitrogenase reductase; Reviewed 91.17
PRK12339197 2-phosphoglycerate kinase; Provisional 91.05
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 90.61
PRK13185269 chlL protochlorophyllide reductase iron-sulfur ATP-bind 90.05
PRK04841903 transcriptional regulator MalT; Provisional 96.04
PRK13230292 nitrogenase reductase-like protein; Reviewed 94.81
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 94.48
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 93.59
PRK13232273 nifH nitrogenase reductase; Reviewed 93.06
PRK06761281 hypothetical protein; Provisional 92.62
pfam09848 348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 92.43
PRK02362 736 ski2-like helicase; Provisional 90.98
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 90.41
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 95.49
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 94.39
PRK06851368 hypothetical protein; Provisional 94.71
PRK12402 337 replication factor C small subunit 2; Reviewed 94.64
PTZ002431560 ABC transporter; Provisional 94.13
COG1192259 Soj ATPases involved in chromosome partitioning [Cell d 93.12
PRK13641 286 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.49
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 92.38
KOG00541381 consensus 92.33
KOG0733 802 consensus 92.24
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 92.11
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 91.19
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 90.5
KOG3347176 consensus 90.35
PRK06547184 hypothetical protein; Provisional 90.3
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 90.23
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 94.55
pfam00772103 DnaB DnaB-like helicase N terminal domain. The hexameri 94.48
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 91.87
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08694 consensus Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08082 consensus Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07263 consensus Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase; InterPro: IPR007692 This family includes the replicative DNA helicases, helicase DnaB, which exhibit DNA-dependent ATPase activity Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli Back     alignment and domain information
>pfam03796 DnaB_C DnaB-like helicase C terminal domain Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA; InterPro: IPR004504 RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2373 consensus Back     alignment and domain information
>pfam00154 RecA recA bacterial DNA recombination protein Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>pfam08423 Rad51 Rad51 Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PTZ00035 Rad51; Provisional Back     alignment and domain information
>PRK09519 recA recombinase A; Reviewed Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB; InterPro: IPR011939 This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO) and DMC1 (IPR011940 from INTERPRO), and archaeal RadA (IPR011938 from INTERPRO) ,, Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC; InterPro: IPR013503 The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA; InterPro: IPR001553 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>pfam02492 cobW CobW/HypB/UreG, nucleotide-binding domain Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA; InterPro: IPR011938 This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO), and archaeal RadB (IPR011939 from INTERPRO) Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information