254781152

254781152

hypothetical protein CLIBASIA_05295

GeneID in NCBI database:8210177Locus tag:CLIBASIA_05295
Protein GI in NCBI database:254781152Protein Accession:YP_003065565.1
Gene range:+(1148576, 1149043)Protein Length:155aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN
cEEEEcccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHEEcccEEEEEEHHHHHHHHHHHHHHHHHcccccHHEEHHHHccccEEcccccHHHHHccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHcEEccccccccccc
cEEEEcccccccccccEEEEcccccHHHHHHHHHHHHHHcHEEEEcccEEccHHHHHHHHHHHHHHHHcccccccccccEEHccccccccccccccccEEccccccccccccccHHcccccccHHHEHHHHHHHHHHHHccEEEccccccEEEcc
mislydrggsipdndkyiagvcgcsiRRWRNIRAILEKFNKIFIqegniynvRVEKEIIKASEERqengrkggikSSQMRILSKKTnnlfqgtlkpahvfqkpesinnysapvdfekinpnpLNLVIALCCATDvlihhygivtsrrkndtiisn
mislydrggsipdndkyiAGVCGCSIRRWRNIRAILEKFNKifiqegniynvrVEKEIIKAseerqengrkggikssqMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCATDVLIHHygivtsrrkndtiisn
MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN
**S****GGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVE*********************************LFQGTLK*****************VDFEKINPNPLNLVIALCCATDVLIHHYGIVTSRRK*******
MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKAS*************SSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN
MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQ************MRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCATDVLIHHYGIVTSRRKND**I**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN
MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN
MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target155 hypothetical protein CLIBASIA_05295 [Candidatus Liberib
315122541223 hypothetical protein CKC_03965 [Candidatus Liberibacter 1 4e-39
13471982232 hypothetical protein mll2129 [Mesorhizobium loti MAFF30 1 0.003
18071243217 hypothetical protein PBC5p49 [Sinorhizobium phage PBC5] 2 0.001
240850004107 phage related protein [Bartonella grahamii as4aup] Leng 2 0.002
>gi|315122541|ref|YP_004063030.1| hypothetical protein CKC_03965 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 223 Back     alignment and organism information
 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 92/111 (82%), Gaps = 3/111 (2%)

Query: 4   LYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKAS- 62
           +YDRGGS+PDNDKYIAGVCGCSIR+WR+IR +LEK NKIF + GNIYN RVEKE+IKA  
Sbjct: 36  MYDRGGSVPDNDKYIAGVCGCSIRKWRSIRIVLEKANKIFSKGGNIYNYRVEKEMIKAMK 95

Query: 63  --EERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSA 111
             EERQENGRKGGIKSSQMR L+ K NNLFQG L+ AH   KPE+IN  ++
Sbjct: 96  AIEERQENGRKGGIKSSQMRTLTHKNNNLFQGILESAHASYKPEAINKKTS 146


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|13471982|ref|NP_103549.1| hypothetical protein mll2129 [Mesorhizobium loti MAFF303099] Length = 232 Back     alignment and organism information
>gi|18071243|ref|NP_542309.1| hypothetical protein PBC5p49 [Sinorhizobium phage PBC5] Length = 217 Back     alignment and organism information
>gi|240850004|ref|YP_002971397.1| phage related protein [Bartonella grahamii as4aup] Length = 107 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target155 hypothetical protein CLIBASIA_05295 [Candidatus Liberib
pfam0712088 pfam07120, DUF1376, Protein of unknown function (DUF137 2e-09
COG3756153 COG3756, COG3756, Uncharacterized protein conserved in 2e-06
>gnl|CDD|148622 pfam07120, DUF1376, Protein of unknown function (DUF1376) Back     alignment and domain information
>gnl|CDD|33551 COG3756, COG3756, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 155 hypothetical protein CLIBASIA_05295 [Candidatus Liberib
pfam0712088 DUF1376 Protein of unknown function (DUF1376). This fam 99.38
COG3756153 Uncharacterized protein conserved in bacteria [Function 97.87
>pfam07120 DUF1376 Protein of unknown function (DUF1376) Back     alignment and domain information
>COG3756 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target155 hypothetical protein CLIBASIA_05295 [Candidatus Liberib
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated PIT, 0.004
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
 Score = 36.1 bits (82), Expect = 0.004
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 25/86 (29%)

Query: 25  SIRRWR-NIRAILEKFN---KIFIQEGNIYNVRVEKEIIKASEERQE-NGRKGGIKSSQM 79
           SIR+WR   R  L++ +   K+  QE         +E  KA ++ +E N R    +S Q+
Sbjct: 86  SIRKWREEQRKRLQELDAASKVMEQEW--------RE--KAKKDLEEWNQR----QSEQV 131

Query: 80  RILSKKTNNLFQGTLKPAHVFQKPES 105
                K NN     +     +Q+P++
Sbjct: 132 E--KNKINN----RIADKAFYQQPDA 151


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target155 hypothetical protein CLIBASIA_05295 [Candidatus Liberib
3go5_A285 Multidomain protein with S1 RNA-binding domains; joint 94.9
>3go5_A Multidomain protein with S1 RNA-binding domains; joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.40A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
Probab=94.90  E-value=0.035  Score=32.67  Aligned_cols=48  Identities=25%  Similarity=0.173  Sum_probs=43.1

Q ss_pred             CHHCCCCCCCCHH----HHHHHHHCCCHHHHHHHHHHHHHCCCEEEECCCEE
Q ss_conf             1000489875027----99977719999999999999985391899389242
Q gi|254781152|r    3 SLYDRGGSIPDND----KYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIY   50 (155)
Q Consensus         3 ~MYdrGgPL~~N~----r~LAg~CGCSvKkFr~aLd~Ll~~GKI~l~DG~LW   50 (155)
                      .|.++||.++.+|    +.+....|+|++.|-+|+-.|++.++|.+.+++++
T Consensus       232 ~L~~~~g~l~~~DkS~pe~I~~~f~~SK~~fK~aiG~L~K~~~I~~~~~~i~  283 (285)
T 3go5_A          232 YLESNGGFMTLNDKSSPDDIKATFGISKGQFKKALGGLMKAGKIKQDQFGTE  283 (285)
T ss_dssp             HHHHTTTEESCCTTSCHHHHHHHHSSCHHHHHHHHHHHHHTTCEEEETTEEE
T ss_pred             HHHHCCCEEECCCCCCHHHHHHHHCCCHHHHHHHHHHHHCCCEEEEECCEEE
T ss_conf             9997699160699999999999879099999998567641865999499799




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target155 hypothetical protein CLIBASIA_05295 [Candidatus Liberib
3go5_A_220-28566 Multidomain protein with S1 RNA-binding domains; s 95.3
>3go5_A (A:220-285) Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
Probab=95.30  E-value=0.032  Score=33.74  Aligned_cols=47  Identities=26%  Similarity=0.187  Sum_probs=41.2

Q ss_pred             HHCCCCCCCCHH----HHHHHHHCCCHHHHHHHHHHHHHCCCEEEECCCEE
Q ss_conf             000489875027----99977719999999999999985391899389242
Q gi|254781152|r    4 LYDRGGSIPDND----KYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIY   50 (155)
Q Consensus         4 MYdrGgPL~~N~----r~LAg~CGCSvKkFr~aLd~Ll~~GKI~l~DG~LW   50 (155)
                      |=++||-+|.++    +.+..+.|+|++.|-+|+-.|++.++|.+.+++++
T Consensus        14 L~~~gG~lpl~DKS~pe~I~~~fg~SKkaFKrAiG~L~K~~~I~i~~~gI~   64 (66)
T 3go5_A           14 LESNGGFXTLNDKSSPDDIKATFGISKGQFKKALGGLXKAGKIKQDQFGTE   64 (66)
T ss_dssp             HHHTTTEESCCTTSCHHHHHHHHSSCHHHHHHHHHHHHHTTCEEEETTEEE
T ss_pred             HHHCCCEECCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCEEEEECCEEE
T ss_conf             997699213799999999999979079999999888865877999389799