254781151

254781151

hypothetical protein CLIBASIA_05290

GeneID in NCBI database:8210176Locus tag:CLIBASIA_05290
Protein GI in NCBI database:254781151Protein Accession:YP_003065564.1
Gene range:+(1148476, 1148592)Protein Length:38aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------
MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV
ccccccHHHHccHHHHHHHHHHHHHccccEEEEEEEEc
ccccccccccccHHHHHHHHHHHHHHcccHHHHHHHcc
mvnnrpwykrypanFISGILELTLEQKGAYSIILDLIV
mvnnrpwykrypaNFISGILELTLEQKGAYSIILDLIV
MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV
****RPWYKRYPANFISGILELTLEQKGAYSIILDLIV
MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV
***NRPWYKRYPANFISGILELTLEQKGAYSIILDLIV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooo
iiiihhhhhhhhhhhhhhhhhhhhoooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target38 hypothetical protein CLIBASIA_05290 [Candidatus Liberib
315122541 223 hypothetical protein CKC_03965 [Candidatus Liberibacter 1 3e-11
>gi|315122541|ref|YP_004063030.1| hypothetical protein CKC_03965 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 223 Back     alignment and organism information
 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 36/36 (100%)

Query: 2  VNNRPWYKRYPANFISGILELTLEQKGAYSIILDLI 37
          +NNRPWYKRYPA+FISG+LELTLEQKGAYSII+DL+
Sbjct: 1  MNNRPWYKRYPADFISGVLELTLEQKGAYSIIIDLM 36


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 38 hypothetical protein CLIBASIA_05290 [Candidatus Liberib
pfam0712088 DUF1376 Protein of unknown function (DUF1376). This fam 91.36
>pfam07120 DUF1376 Protein of unknown function (DUF1376) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00