254781153

254781153

hypothetical protein CLIBASIA_05300

GeneID in NCBI database:8210178Locus tag:CLIBASIA_05300
Protein GI in NCBI database:254781153Protein Accession:YP_003065566.1
Gene range:+(1149484, 1149576)Protein Length:30aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
90% MSAconservation map
  
--------10--------20--------30
MANNTGLSPIQAGEKRVNVDDKRILTNIVD
ccccccccHHHcccEEccccHHHHHHHHcc
ccccccccccccccEEEEcccHHHHHcccc
manntglspiqagekrvnvddkriltnivd
manntglspiqagekrvnvddkriltnivd
MANNTGLSPIQAGEKRVNVDDKRILTNIVD
***********AGEKRVNVDDKRILTNIV*
MANNTGLSPIQAGEKRVNVDDKRILTNIVD
******LSPI*AGEKRVNVDDKRILTNIVD
oooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooo
iiiiiiiihhhhhhhhhhhhhhhhhhhooo
iiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANNTGLSPIQAGEKRVNVDDKRILTNIVD
MANNTGLSPIQAGEKRVNVDDKRILTNIVD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target30 hypothetical protein CLIBASIA_05300 [Candidatus Liberib
254780964 352 ribonucleotide-diphosphate reductase subunit beta 3e-10
254780845 352 ribonucleotide-diphosphate reductase subunit beta 3e-10
>gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment
 Score = 54.7 bits (130), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 25/25 (100%)

Query: 1  MANNTGLSPIQAGEKRVNVDDKRIL 25
          MANNTGLSPIQAGEKRVNVDDKR+L
Sbjct: 1  MANNTGLSPIQAGEKRVNVDDKRML 25

>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment
 Score = 54.7 bits (130), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 25/25 (100%)

Query: 1  MANNTGLSPIQAGEKRVNVDDKRIL 25
          MANNTGLSPIQAGEKRVNVDDKR+L
Sbjct: 1  MANNTGLSPIQAGEKRVNVDDKRML 25

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target30 hypothetical protein CLIBASIA_05300 [Candidatus Liberib
254780845 352 ribonucleotide-diphosphate reductase subunit beta [Cand 1 4e-06
>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment and organism information
 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 25/25 (100%)

Query: 1  MANNTGLSPIQAGEKRVNVDDKRIL 25
          MANNTGLSPIQAGEKRVNVDDKR+L
Sbjct: 1  MANNTGLSPIQAGEKRVNVDDKRML 25


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00