254781154

254781154

hypothetical protein CLIBASIA_05305

GeneID in NCBI database:8210179Locus tag:CLIBASIA_05305
Protein GI in NCBI database:254781154Protein Accession:YP_003065567.1
Gene range:+(1150127, 1150324)Protein Length:65aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60-----
MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLSYVYTF
ccccEEEEcccEEEEEEcHHHccHHEEEEEEEEccHHHHHHccccccccccccEEEEEEEEEEEc
ccHHHHHHHHccEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcEEEEEc
MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALissdknitesgKEGIVKMDLSYVYTF
MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISsdknitesgkegivkmdLSYVYTF
MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLSYVYTF
**SWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISS*********EGIVKMDLSYVYTF
MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLSYVYTF
*TSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLSYVYTF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLSYVYTF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target65 hypothetical protein CLIBASIA_05305 [Candidatus Liberib
254780963215 hypothetical protein CLIBASIA_04320 [Candidatus Li 9e-05
>gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Back     alignment
 Score = 36.6 bits (83), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 2   TSWLKLQRDFGVVLIGDKAFNTYRSQLRILITD-------NLSALISS-DKNITESGKEG 53
           T WL LQ DF +           R Q + LITD       N+SA+ ++ DKNI      G
Sbjct: 148 TPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNI----GLG 203

Query: 54  IVKMDLSYVYTF 65
           + K+ L YVY F
Sbjct: 204 VTKIGLDYVYKF 215

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00